KEGG   Caldivirga maquilingensis: Cmaq_1304Help
Entry
Cmaq_1304         CDS       T00611                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K22969  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
cma  Caldivirga maquilingensis
Pathway
cma00030  Pentose phosphate pathway
cma01100  Metabolic pathways
cma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Cmaq_1304
Enzymes [BR:cma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     Cmaq_1304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu_dehyd_C ADH_N ADH_zinc_N Shikimate_DH Choline_kin_N FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ABW02131
UniProt: A8M8R2
Position
1378099..1379169
Genome map
AA seq 356 aa AA seqDB search
MVEYLTLMKAVTVIPSVPESLRLRDVDKPKPNHGQVLLKPIRVGICGTDKEIIEGKYGKA
PPGSQYLILGHEALAVVEELGDGVDNVAVGDVVVPTVRRPLDCNLPVDYCPMGHYVEHGI
WGLHGHAAEYSVTDAKYLVKVPKELIDVAVLTEPLSVVEKGIDVALSVGGSRFEWRPRSA
LILGAGPIGLLSTMVLRLMGLLTTTVATRPPDSLKARLVRELGGVYVDSALSSIEGVFDL
VVEATGSPQVMVDGLRHLAPNGVMVLLGVYPPGGVINDLGNVLTDSVLNNKVLVGSVNAG
VKHFELGLRHMAEAKGRFGDWLSRLITKRATLDNYQEAYSWTHDDIKTVLEINPLN
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgaatacctaacgctaatgaaggcggtaacagttattcccagtgtcccggagtcc
ttaagattaagagatgttgataagcctaaacctaatcatggtcaagtactacttaagccg
attagggttgggatatgtggtacagataaggagattattgaaggcaagtacggtaaggca
ccaccgggtagtcaatacctgatacttggtcatgaggcgttagcggtcgtggaggagctt
ggggatggtgtggataatgtggctgtgggcgatgtcgtggtaccaacggttaggagaccc
cttgactgcaacctacccgttgactactgtccaatggggcattacgtggagcatggtata
tgggggcttcatgggcatgcagccgaatactcagtaacagacgccaagtaccttgttaag
gtacccaaggagttaattgatgtggccgtattaacagagccattaagcgtagttgagaag
ggtattgatgtggcgcttagcgtaggtggttcaaggttcgagtggaggcctaggagtgcg
ttaatacttggggctgggccaataggcctactctcaacaatggttcttagattaatgggc
ctattaacaaccaccgtagccactaggcctcctgatagtcttaaggctaggttggttagg
gaattggggggagtttacgtggattctgcattaagcagcatagagggtgtctttgaccta
gtggtggaggcaacaggatccccccaggtcatggtggatggtttaaggcacctagcccct
aatggagtaatggtgctcctcggggtttacccacctggtggggttattaatgacttaggt
aatgtgttaacggactcagtccttaataataaggttttagttggatcagtgaatgctggt
gttaagcactttgaattaggcttaaggcatatggctgaggctaagggtaggtttggtgac
tggcttagtagattaatcacgaagagggctacccttgataattaccaggaagcctactcc
tggacccatgacgacattaagaccgtccttgaaataaacccacttaattaa

DBGET integrated database retrieval system