KEGG   Caldivirga maquilingensis: Cmaq_1473Help
Entry
Cmaq_1473         CDS       T00611                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
cma  Caldivirga maquilingensis
Pathway
cma00521  Streptomycin biosynthesis
cma00523  Polyketide sugar unit biosynthesis
cma01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cma00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Cmaq_1473
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cmaq_1473
Enzymes [BR:cma01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Cmaq_1473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ABW02297
UniProt: A8M978
Position
complement(1550463..1551029)
Genome map
AA seq 188 aa AA seqDB search
MPFLSFKRLEIPDVILIEYQRFPDHRGFFAELWKRTDFLANGVFYDFTQLSTSVSRRGVV
RGLHYQLKPMEQGKLVTVLRGRVIDVAVDVRKGSPWFGKHVAVELSTNEPRLLWVPPGFA
HGFQALEDDTVFLYLMTKEYSPQHERCVKWDDPELGIEWPIRSNVIISEKDSKCPPLKAA
ETNFNYPI
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgccgttccttagctttaagagactggaaatacctgacgttattttaatagagtatcaa
cgcttcccggaccataggggtttctttgctgagctttggaagcgaaccgacttcctagct
aatggggtgttctatgacttcactcaattgagtacatcagtctcaaggaggggtgtggtt
aggggtcttcattatcagcttaagcccatggagcagggtaagttggtgactgtactgagg
ggtcgtgtgattgatgtggctgttgatgtacgtaagggttctccctggttcggtaagcat
gtggccgtggagttgagcaccaatgaaccaaggctactctgggtgcctcccggcttcgcc
catggtttccaggcccttgaggacgacacagtattcctctacctaatgactaaggagtat
agtccgcaacacgagaggtgcgtgaaatgggatgaccctgagttaggcattgaatggcca
attagaagtaatgtaataatcagtgaaaaggactccaagtgcccacccctcaaggccgct
gaaacaaacttcaactacccaatataa

DBGET integrated database retrieval system