KEGG   Caldivirga maquilingensis: Cmaq_1552Help
Entry
Cmaq_1552         CDS       T00611                                 

Definition
(GenBank) DNA topoisomerase (ATP-hydrolyzing)
  KO
K03166  DNA topoisomerase VI subunit A [EC:5.6.2.2]
Organism
cma  Caldivirga maquilingensis
Brite
KEGG Orthology (KO) [BR:cma00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cma03032]
    Cmaq_1552
Enzymes [BR:cma01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     Cmaq_1552
DNA replication proteins [BR:cma03032]
 Prokaryotic Type
  DNA Topoisomerases
   Cmaq_1552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP6A_N DUF2399
Motif
Other DBs
NCBI-ProteinID: ABW02375
UniProt: A8M9F6
Position
complement(1633287..1634396)
Genome map
AA seq 369 aa AA seqDB search
MVKDRGEALKVLEDWGRSIVDYINKGEEPVMRIPARTLTNIIWDEKRKILVLGPKAIERR
FLDLNEAKRFMQTTLMLKLIIQSIKENVYPTIRDLYYNGKHTMELNEPKLSKSFRENTWD
EQSESNAVIEDIEVATGVLREEMGVSADVKGKVVGPIVVRSKGFEIDATKMGDTALSLPP
NPDELDIVRMDAKYVLVVEKDAIFQRLNREGYWNSEKCLLVTAKGMPDRATRRFVRRLSE
DYGLPVYVFTDGDPYGWYIYSVYRSGSIKLSYENERLATPDAKFIGVTASDISKYKISDN
YVIKATDRDIKRAQELKKYPWFQSHEWKRELDLFLRTRKKVEIEALSTHGLKFLHEYLLD
KIHNNKWIE
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggttaaggataggggtgaagcactcaaggttcttgaggattggggtaggtctattgtt
gactacattaataagggtgaggagccggtgatgcgtatacctgctaggactttaactaat
attatatgggatgagaagaggaagatactggtactggggcctaaggctattgagaggagg
ttcctggatttaaatgaggctaagcgctttatgcagactacactgatgcttaagctcatt
attcaatcaattaaggagaacgtttacccaaccataagggacctttactataatggtaaa
cacaccatggagcttaatgaacctaagttgagtaagtcatttagggagaatacgtgggat
gagcagtctgagtccaatgcagtaatagaggatattgaggttgccacaggtgtgcttagg
gaggagatgggtgtgtccgctgatgttaagggtaaggttgttggacccattgtggttagg
tcaaagggtttcgaaatagatgcgacaaaaatgggtgatacagccttaagcctacctccg
aatccagatgaattagatatcgttagaatggatgctaagtatgttttagtggttgagaag
gatgcaatattccaaaggcttaatagggagggttactggaatagtgaaaaatgcctactg
gttaccgctaagggtatgcccgatagggctactaggaggttcgttaggaggcttagtgag
gattacggtttaccggtttacgtcttcactgatggggacccatacggatggtacatttac
agtgtatacaggagtggttcaataaagttgagttacgagaatgagaggttagccacccct
gatgctaaattcattggggtgactgcaagcgatataagtaagtataagatcagtgataat
tacgtaataaaggccactgatagggatattaaaagggctcaggaacttaagaagtaccca
tggttccagagtcatgaatggaagagggaactggacctattcctgagaactaggaagaag
gttgagattgaggcgttgtcgacgcatggattaaagttcctacacgagtacctgctggat
aagattcataataataagtggattgagtaa

DBGET integrated database retrieval system