KEGG   Caldivirga maquilingensis: Cmaq_1790Help
Entry
Cmaq_1790         CDS       T00611                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type II
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
cma  Caldivirga maquilingensis
Pathway
cma00010  Glycolysis / Gluconeogenesis
cma01100  Metabolic pathways
cma01110  Biosynthesis of secondary metabolites
cma01120  Microbial metabolism in diverse environments
cma01130  Biosynthesis of antibiotics
cma01200  Carbon metabolism
cma01230  Biosynthesis of amino acids
Module
cma_M00002  Glycolysis, core module involving three-carbon compounds
cma_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cmaq_1790
Enzymes [BR:cma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Cmaq_1790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N GFO_IDH_MocA NAD_binding_3 2-Hacid_dh_C Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ABW02613
UniProt: A8MAY4
Position
1864861..1865886
Genome map
AA seq 341 aa AA seqDB search
MPVNVAINGYGTIGKRVADAVMKQPDMKLVGVAKTSPNYEAFIAHRKGIKIYVPQQSIKK
FDEVGIPVAGTIEDLIKAADIIVDATPNGVGAQYKLIYQQLQKNAIFQGGEKAEIADASF
SALCNYNEALGKKYIRVVSCNTTALLRTICAINKVSKVEKVRATIVRRAADQKEVKKGPI
NSLVPDPALVPSHHAKDVNSVIRNLDIVTMAVIAPTTLMHMHFINITLRDRVEKKDALSV
LENTPRIVLVSSKYGAEATAELVEVARDLRRDRNDIPEVMVFSDSVYVKDNEVMFMYAVH
QESIVVPENIDAIRASMRLMSAEDSIRITNESLGILKGYLI
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgccagttaacgtagctattaatggctatggtaccatagggaagagagttgctgatgcc
gtcatgaaacaaccagacatgaaactagtgggagttgcgaaaacatccccaaattacgaa
gcatttatagcacatcgcaagggaataaagatctacgtaccgcagcagtctattaagaaa
tttgatgaggttggaataccagtggcaggtacaatagaggatctaataaaagccgcagat
attatagtggatgctacacccaatggtgttggtgctcaatataaattaatttaccaacaa
ttacagaaaaacgccatatttcaaggaggtgaaaaagcagagatagccgatgcttcattc
tcagccttatgtaattacaatgaagcccttggtaaaaaatacattagagtagtatcgtgt
aacactacagcactacttagaacaatatgcgcaataaataaggtcagtaaagtggagaaa
gttagagcaacgatagttagaagagccgctgatcaaaaggaggttaagaaaggtcccata
aattcactagtacctgatcctgcattagtgccgagccatcatgcaaaagatgttaacagt
gtcataaggaatttagatatagttacgatggcagtaatagccccaacaacattaatgcat
atgcactttatcaatataaccttaagagacagagtagagaagaaagatgcactcagcgtt
ctggagaatactcctagaatagtcctagtttcttcaaagtatggtgcagaagccacagca
gaattagtagaagtagcgagggatttaagaagagatagaaatgatattccagaggtaatg
gtatttagtgactcggtttacgttaaggataatgaagtcatgttcatgtacgcagtgcac
caagaatcaatagtggtgccagagaatatagatgcaataagagcctccatgagattaatg
agcgcggaagactcaataagaatcactaatgaaagcttaggaatattaaaggggtatcta
atatga

DBGET integrated database retrieval system