KEGG   Caldivirga maquilingensis: Cmaq_1863Help
Entry
Cmaq_1863         CDS       T00611                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
cma  Caldivirga maquilingensis
Pathway
cma00010  Glycolysis / Gluconeogenesis
cma00020  Citrate cycle (TCA cycle)
cma00620  Pyruvate metabolism
cma00633  Nitrotoluene degradation
cma00640  Propanoate metabolism
cma00650  Butanoate metabolism
cma00680  Methane metabolism
cma00720  Carbon fixation pathways in prokaryotes
cma01100  Metabolic pathways
cma01120  Microbial metabolism in diverse environments
cma01130  Biosynthesis of antibiotics
cma01200  Carbon metabolism
Module
cma_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cmaq_1863
   00020 Citrate cycle (TCA cycle)
    Cmaq_1863
   00620 Pyruvate metabolism
    Cmaq_1863
   00640 Propanoate metabolism
    Cmaq_1863
   00650 Butanoate metabolism
    Cmaq_1863
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Cmaq_1863
   00680 Methane metabolism
    Cmaq_1863
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Cmaq_1863
Enzymes [BR:cma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Cmaq_1863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: ABW02680
UniProt: A8MB51
Position
complement(1938030..1938593)
Genome map
AA seq 187 aa AA seqDB search
MEGLSRIDITFYGRGGQGAVTAAQVLAEAAIHSGLFASAFPEYGAERRGAPVRAYVRVAN
QYLGIREPIEKPDVSVVFDTRLIDVFNITKITKPNGTIVINSSEDYAKQMLSQFNGKVVY
VDAYGISMKYLGKAIVNTPMLGALLRVIGMINIEVVKELIRNTFRGRIGQLNAEAIDEAY
KLARVIP
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggagggtttaagccgcatagacataacgttctacggtagaggaggacaaggtgcagtc
actgcggcgcaggttttagctgaggctgcaatacacagtggcttatttgcatcagcgttc
cctgagtatggggctgaacgtaggggtgccccagttagggcttacgtgagggttgctaac
cagtaccttggtattagggaacccatagagaagcctgatgtatcagtggttttcgatacg
aggcttattgatgtatttaacataactaagataactaaaccaaatggtacaatagtgata
aattccagtgaggattacgctaaacagatgcttagccaatttaacggtaaggtggtttac
gtggatgcatacggcatatccatgaagtaccttggtaaggccatagtaaacacaccaatg
ctcggcgcattattgagggtgatagggatgattaatattgaggtggttaaggagttaatt
agaaacactttcagggggaggattggtcaattaaacgctgaggcaattgatgaggcgtat
aagttggctagggtgataccatga

DBGET integrated database retrieval system