KEGG   Celeribacter manganoxidans: CBW24_07440Help
Entry
CBW24_07440       CDS       T05128                                 

Definition
(GenBank) aminotransferase
  KO
K04487  cysteine desulfurase [EC:2.8.1.7]
Organism
cmag  Celeribacter manganoxidans
Pathway
cmag00730  Thiamine metabolism
cmag01100  Metabolic pathways
cmag04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:cmag00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    CBW24_07440
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    CBW24_07440
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cmag03016]
    CBW24_07440
   03029 Mitochondrial biogenesis [BR:cmag03029]
    CBW24_07440
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:cmag02048]
    CBW24_07440
Enzymes [BR:cmag01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     CBW24_07440
Transfer RNA biogenesis [BR:cmag03016]
 Eukaryotic Type
  tRNA modification factors
   Thiolation factors
    CBW24_07440
 Prokaryotic Type
    CBW24_07440
Mitochondrial biogenesis [BR:cmag03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    CBW24_07440
Prokaryotic defense system [BR:cmag02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   CBW24_07440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ATI41846
UniProt: A0A291LYM7
Position
1654466..1655542
Genome map
AA seq 358 aa AA seqDB search
MVRTRAYLDWNATTPLRAEARAAMIAAMDIVGNPSSVHAEGRAAKALVEKSRGQIAEAFG
ADGADIVFTSSATEAAALALEGRDLAAAGIEHDAVGAWTAPSLVVDAAGAVTVPDPARAT
LQLANSETGVVQTLPDGLAVSDMTQAFGKLPLAFNWTGAQMALISAHKLGGPKGIGALVL
RRGTDLAPRIRGGGQEMGRRSGTENVIGIAGFAAAAQAAMRDLESGVWERVAQFRNILEK
ALESESKEIILVGKGTDGAAGSGAAQRLPNTSCIAVPGWKGETQVMQMDLAGFAISAGSA
CSSGKVRASRVLQAMGHDDTTAASAIRVSLGPDTTENEVHRFAEAWIAQYRKYCARAA
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggtccgcacccgcgcctatctggactggaacgccacgacgcccctgcgggccgaggct
cgcgccgcgatgatcgcggcgatggacatcgtgggcaatccgtcctcggtccatgccgaa
ggtcgcgcggcgaaggccttggtcgagaaatcccgtgggcagatcgccgaggccttcggt
gccgatggggcggatatcgtttttaccagttccgccaccgaagcggcggcgctcgcgctc
gaggggcgcgatctggcggctgcggggatcgagcatgacgcggtcggcgcgtggactgcg
ccctctcttgtcgtggatgctgccggggcggtcaccgtgcctgatccggcccgtgcgacg
ctgcaacttgccaattcggaaaccggcgtggtgcagaccttgcccgatgggctggcggtg
tcggacatgacccaagcctttggcaagctgcctttggcgttcaactggaccggcgcgcag
atggcgctcatttcggcgcataagctgggcgggccaaaaggcatcggcgcactggttttg
cgccggggcaccgatctggcgccgcgcatccggggcggcgggcaggagatgggccgccgc
tcgggcaccgaaaacgtcatcggcatcgccggtttcgccgctgcggcgcaggcggcgatg
cgcgatctggagagcggcgtttgggaacgggttgcgcaatttagaaatattctagaaaag
gcgctggaatccgagtcaaaggagattattttggtcgggaaaggcaccgatggtgcggca
gggtccggggcagcgcagcgtttgcccaacaccagctgcatcgcggtgccgggatggaag
ggcgaaacccaggtcatgcagatggaccttgccgggttcgccatttccgccgggtcggcc
tgttccagtggcaaggttcgcgccagccgggtgttgcaggccatgggccacgacgacacg
accgctgccagcgccatccgggtctcactcggcccggacacgacagaaaacgaggtccac
cgcttcgccgaggcgtggatcgctcaatatcgcaagtattgcgcccgcgcggcgtga

DBGET integrated database retrieval system