KEGG   Celeribacter manganoxidans: CBW24_13100Help
Entry
CBW24_13100       CDS       T05128                                 

Definition
(GenBank) succinate--CoA ligase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cmag  Celeribacter manganoxidans
Pathway
cmag00020  Citrate cycle (TCA cycle)
cmag00640  Propanoate metabolism
cmag00660  C5-Branched dibasic acid metabolism
cmag01100  Metabolic pathways
cmag01110  Biosynthesis of secondary metabolites
cmag01120  Microbial metabolism in diverse environments
cmag01130  Biosynthesis of antibiotics
cmag01200  Carbon metabolism
Module
cmag_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cmag_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cmag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CBW24_13100
   00640 Propanoate metabolism
    CBW24_13100
   00660 C5-Branched dibasic acid metabolism
    CBW24_13100
Enzymes [BR:cmag01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CBW24_13100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ATI42845
UniProt: A0A291M299
Position
2879551..2880744
Genome map
AA seq 397 aa AA seqDB search
MNIHEYQAKALLRDYGAPVSDGRVVLKAEDAKTAAGEMDGPLWVVKAQIHAGGRGKGSFK
EADAGEKGGVRLAKSVEEAAEEAKKMLGRTLVTHQTGPAGKQVNRIYIEDGSDIETELYL
ALLVDRQTSRISFVCSTEGGMDIEEVAASTPEKILSFSVDPATGYQPFHGRRVAFSLGLT
GKQVKECVRLMGILYQAFVEKDMEMLEINPLIVTDEGSLKVLDAKVGFDGNAIYRHADIA
ALRDETEEDPKELAASKYDLNYIALDGEIGCMVNGAGLAMATMDIIKLKGAEPANFLDVG
GGATKEKVTEAFKIITSDKNVKGILVNIFGGIMRCDVIAEGVIAAVKEVGLQVPLVVRLE
GTNVEKGKEIISNSGLNVIAADDLSDAAEKIVKAVKG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtgaacatccatgaataccaggcgaaggcgctgcttcgcgactatggcgccccggtctct
gatggccgtgtcgtcctgaaggccgaagacgccaagaccgccgccggcgaaatggacggc
ccgctttgggtcgttaaggcgcaaatccacgccggtggccgcggcaagggctccttcaag
gaagccgacgctggcgaaaaaggcggtgtccgccttgccaaatccgtcgaggaagccgcc
gaagaagccaagaagatgctgggccgcacgctcgtcacgcatcagaccggccccgcaggc
aaacaagtcaaccggatctacatcgaagacggttcggacatcgagactgagctttacctc
gcgctgctggtggatcgccagacgtcgcgcatctcgttcgtgtgctccaccgagggcggc
atggacatcgaggaggtcgccgcgtcgacccctgagaaaatcctcagcttctccgtcgat
ccggcgaccggctaccagccgttccacggccgccgcgttgccttctcgctgggtctgacc
ggcaagcaggtcaaggaatgcgtgcgcctgatgggcattctctaccaagccttcgtcgag
aaggacatggagatgctggagatcaacccgctgatcgtcaccgacgaagggtcgctcaag
gttctggacgccaaggtcggctttgacggcaacgcgatctaccgccatgccgatatcgcc
gccctgcgcgacgagaccgaggaagaccccaaggaactcgccgcatccaagtatgacctg
aactacatcgcgctcgacggtgagatcggctgcatggtgaacggcgcgggccttgccatg
gcgacgatggacatcatcaagctgaaaggcgcggagcctgccaacttcctcgatgtgggc
ggtggcgcgaccaaggaaaaggtcaccgaggcgttcaagatcatcacctcggacaagaac
gtcaaaggtatcctcgtcaacatctttggcggcatcatgcgctgtgacgtcatcgccgag
ggcgtgatcgccgcggtgaaggaagtcggcctgcaggttccgctggttgtccgcctcgaa
ggcaccaatgtcgagaagggcaaggaaatcatcagcaacagcggtctgaacgtgatcgcc
gcagatgacctgagcgacgccgccgagaagatcgtgaaagcggtcaaagggtga

DBGET integrated database retrieval system