KEGG   Cobetia marina: BFX80_01985Help
Entry
BFX80_01985       CDS       T04789                                 

Definition
(GenBank) oxaloacetate decarboxylase subunit alpha
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
cmai  Cobetia marina
Pathway
cmai00620  Pyruvate metabolism
cmai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BFX80_01985
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cmai02000]
    BFX80_01985
Enzymes [BR:cmai01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     BFX80_01985
Transporters [BR:cmai02000]
 Other transporters
  Primary active transporters [TC:3]
   BFX80_01985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 Peptidase_M23 HlyD_D23 DUF4813 RnfC_N
Motif
Other DBs
NCBI-ProteinID: AOM00314
Position
454001..455830
Genome map
AA seq 609 aa AA seqDB search
MDKQPLGITDVVLRDAHQSLLATRMRLDDMLPIAAKLDDIGFWSLESWGGATFDACIRYL
GEDPWARIRALKEAMPKTQQQMLLRAQNLLGYRHYADDVVDAFVKRAATSGVDVFRVFDA
MNDPRNLERPLKAVLDQGKHAQGTISYTVSPVHTLEMWVELAQKIESMGAQSLAIKDMAG
LLTPYTAFELVSRLKASLSIPIHMQCHATTGLSTATALKAIEAGIDNVDTSISSMSMTYG
HSPTESVVAMLAGTERDTGLDLEKLEDIAAYFREVRKKYAAFEGSLRGIDSRILVAQVPG
GMLTNMEGQLKEQGAGDKLDDVLAEIPRVRKDLGYIPLVTPTSQIVGTQSVMNVMMGERY
KSISKEVQALLKGEYGAAPAPFDSELQSRVLEGAEPITCRPADNLTPEMERLREELKGKA
REEGIALESGERETDDVLTYALFPQIGLKFLRNRGNPDAFEPAPQAVDDKASKAAAAPVS
SAPAVSAQGASSGPQTYTLNVNGKQYVVEVAEGGDITQVQASEPAASAPAAAAPAAQAAS
GEPVNAPLAGNIFKVNVAVGDSVAEGDVVIILEAMKMETEIRAHQAGTVSAVKVKEGDSV
SVGDVLITL
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atggacaagcaaccgctgggcatcacggatgtggtactgcgcgacgcgcatcagtcattg
ctggccacgcgcatgcgcctcgatgacatgctgccgatcgccgccaagctggacgacatc
ggcttctggtcgctggagagctggggcggcgcgaccttcgacgcctgcatccgctacctg
ggcgaagacccctgggcgcgcattcgtgccttgaaggaagcgatgcccaagactcagcag
cagatgctgctgcgcgcccagaacctgctcggctatcgtcattacgccgatgacgtggtg
gatgccttcgtcaagcgtgccgcgaccagcggtgtcgatgtcttccgtgtcttcgacgcg
atgaatgacccgcgcaacctcgagcgtccgctcaaggcagtgctggatcagggcaagcat
gcccagggcaccatctcctacaccgtgagccccgtgcacacgctggagatgtgggtggag
ctggcgcagaagatcgagtccatgggggcccagtcgctggcgatcaaggacatggcgggc
ctgctgacgccgtataccgccttcgagctggtctcgcgcctcaaggcgagcctgtcgatc
ccgatccacatgcagtgccatgccaccaccgggctttccaccgccacggctctcaaggcc
atcgaggcgggcatcgacaacgtcgacacctccatctcctcgatgtcgatgacctacggc
cacagcccgaccgaatcggtcgtcgcgatgctggcaggcaccgagcgcgataccggactg
gacctcgagaagctcgaggatatcgcggcctacttccgcgaagtgcgcaagaaatacgcg
gcattcgagggcagtctgcgcggtatcgactcgcgcattctggtcgcccaggtgccgggt
ggcatgctcaccaacatggaaggccagctcaaggagcagggcgccggtgacaagctggat
gacgtgctcgccgagattccgcgcgtacgcaaggacctgggctatatcccgctggtgacc
ccgacctcacagatcgtcggcacccagtcggtgatgaacgtgatgatgggcgagcgctac
aagtcgatctccaaggaagtgcaggcgctgctcaagggggaatatggcgcggcgccggca
cccttcgacagcgaacttcagtcccgcgtgctggaaggcgccgagccgatcacctgccgc
ccggcagacaacctgacgccggagatggagcgtctgcgtgaggagctcaagggcaaggcc
agggaggaaggtatcgcgctggagagcggcgaacgcgagaccgatgacgtgctgacctat
gcactcttcccgcagatcggcctcaagttcctgcgcaaccgtggcaacccggatgccttc
gagcccgccccgcaggctgtcgatgacaaggcatccaaggccgccgcagcgccggtctct
agtgctccggccgtcagtgctcaaggcgcgtcgagcggcccgcagacctacaccctgaac
gtcaacggcaagcagtatgtcgtcgaggttgccgaaggcggagacatcacccaggtgcag
gccagcgagcctgcggcatcggctccggcagccgcggcacctgccgcccaggccgcctcc
ggtgagccggtgaatgcgccgttggcgggcaacatcttcaaggtcaatgtcgccgtcggt
gacagcgtggcggaaggagatgtcgtgatcattctcgaggccatgaagatggagaccgag
atccgtgcccaccaggccggtaccgtctccgcggtgaaggtcaaggaaggcgacagtgtc
agtgtcggcgacgttctgatcaccctctga

DBGET integrated database retrieval system