KEGG   Cobetia marina: BFX80_11350Help
Entry
BFX80_11350       CDS       T04789                                 

Definition
(GenBank) succinyl-CoA--3-ketoacid-CoA transferase
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
cmai  Cobetia marina
Pathway
cmai00072  Synthesis and degradation of ketone bodies
cmai00280  Valine, leucine and isoleucine degradation
cmai00650  Butanoate metabolism
cmai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BFX80_11350
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BFX80_11350
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BFX80_11350
Enzymes [BR:cmai01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     BFX80_11350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: AOM01779
Position
2780869..2781531
Genome map
AA seq 220 aa AA seqDB search
MALTREQMAQRVAQEIQDGSYVNLGIGIPTLVANYIPDGIDVMLQSENGLLGMGRYPYDD
EVDADMINAGKETVTAIDGAAIFDSAESFAMIRGGHVDLTVLGAFEVDVNGNIASWMIPG
KLVKGMGGAMDLVAGAENIICTMTHASKHGESKLLSQCELPLTGAGCIRRVLTDLAFLEI
KDGAFHLLERAPGVSVEEIQRLTAGKLIVPDNVPEMQLDA
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggctttgacacgcgaacagatggcccagcgagtggcacaggaaatccaggacggctcc
tacgtcaatctgggcatcggcattccgaccctggtcgccaactacatcccggatggcatc
gacgtgatgctgcagtccgagaacggcctgcttggcatgggacgctatccctatgacgac
gaggtcgacgccgacatgatcaatgccggcaaggaaaccgtgaccgccatcgatggcgcc
gccatcttcgactccgccgaatccttcgcgatgattcgcggcgggcacgtcgatctgacg
gtactcggcgccttcgaggtggacgtgaacggcaacatcgccagctggatgatccccggc
aagctggtgaaaggcatgggcggcgccatggacctggtggcgggtgccgagaacatcatc
tgcaccatgacccacgcctccaagcatggtgagtccaagctgctcagccagtgtgagctg
ccactgaccggtgccggctgcattcgccgtgtcctgaccgacctggccttcctcgagatc
aaggacggtgccttccacctgctggaacgcgcgccaggcgtcagtgtcgaggagatacag
cgcctgaccgcaggcaagctcatcgtgcccgacaacgtccccgagatgcagctggacgcc
tga

DBGET integrated database retrieval system