KEGG   Cobetia marina: BFX80_16335Help
Entry
BFX80_16335       CDS       T04789                                 

Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
cmai  Cobetia marina
Pathway
cmai00270  Cysteine and methionine metabolism
cmai00920  Sulfur metabolism
cmai01100  Metabolic pathways
cmai01110  Biosynthesis of secondary metabolites
cmai01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cmai00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BFX80_16335
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BFX80_16335
Enzymes [BR:cmai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     BFX80_16335
    2.3.1.46  homoserine O-succinyltransferase
     BFX80_16335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Esterase Abhydrolase_6 Hydrolase_4 Peptidase_S9
Motif
Other DBs
NCBI-ProteinID: AOM03264
Position
3956223..3957416
Genome map
AA seq 397 aa AA seqDB search
MPDSLPPDSVGLVTPRTAHFDTPLELACGRRLEQYSLVYETYGELNADASNALLICHALT
GHHHAAGYHAMSDRKPGWWDDYIGPGKPIDTSRFFVIALNNIGGCHGSTGPTSINPDTGE
QWGPDFPLVTVPDWVESQKRLAERLGITRFAAVVGGSLGGMQALQWAMDHPERVGHVAII
ACTPKLSAQNIAFNEVARQAIRSDPEFHDGWYSRVDAVPKRGLKLARMVGHITYLSEHSM
GTKFGRDLRQDRLNFGYDVDFQVESYLRHQGDTFSTAFDANTYLLMTKALDYFDPAATAG
DDLAAAMAPISCPVLVVSFTTDWRFAPSRSRELVNAMIHAGKNVSYANIDSPHGHDAFLL
PGERYQAVLGNFLTRAYDKACNAASPLHTAPQEASHA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgcctgattcccttcccccggattcggtcggtctcgtcacgccccggactgcccacttc
gatacaccgctggagctggcctgcggcagacgtctcgaacagtactcgctggtctacgag
acctatggcgagctgaacgctgacgccagcaacgccctcctgatctgccacgccctgacc
ggacaccatcatgccgccggctaccacgcgatgagtgatcgcaagcccggctggtgggac
gactacatcggccccggcaagcccatcgatacctcacgcttcttcgtcatcgcgctgaac
aatatcggcggctgtcacggcagtaccggcccgacctcgatcaacccggatacgggcgaa
caatggggccccgatttcccgctggtgaccgtgccggactgggtcgagagtcagaagcgc
ctcgccgaacgtctcggcatcacgcgcttcgccgcggtggtcggtggctcactgggcggc
atgcaggcactgcagtgggcgatggatcatcccgagcgcgtcgggcacgtcgccatcatc
gcctgtacccccaagctctcggcgcagaacatcgccttcaacgaagtcgcgcgccaggcc
atccgctcggacccggaattccatgacggctggtactcacgcgtcgatgccgtgcccaag
cgcggtctcaagctggcccgcatggtcggtcacatcacctatctttccgagcactcgatg
gggaccaagttcgggcgtgacctgcgccaggaccgcctcaacttcggttacgacgtcgac
ttccaggtcgagagctatctgcgccatcagggcgacaccttctccaccgccttcgacgcc
aacacctacctgctgatgaccaaggcactcgattacttcgatcccgccgccacggccggc
gatgatctggccgcggccatggcaccgatcagctgcccggtgctcgtcgtcagcttcacc
accgactggcgcttcgctccttcacgctcgcgcgagctggtcaacgccatgatccatgcc
ggcaagaacgtcagttatgccaacatcgattctcctcacggccatgacgccttcctgctg
ccgggagagcgctatcaggcagtgctgggcaacttcctgacccgcgcatacgacaaggcc
tgcaacgcagcctctcccctgcacaccgctccccaggaggccagccatgcgtaa

DBGET integrated database retrieval system