KEGG   Cobetia marina: BFX80_16410Help
Entry
BFX80_16410       CDS       T04789                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cmai  Cobetia marina
Pathway
cmai00071  Fatty acid degradation
cmai00072  Synthesis and degradation of ketone bodies
cmai00280  Valine, leucine and isoleucine degradation
cmai00310  Lysine degradation
cmai00362  Benzoate degradation
cmai00380  Tryptophan metabolism
cmai00620  Pyruvate metabolism
cmai00630  Glyoxylate and dicarboxylate metabolism
cmai00640  Propanoate metabolism
cmai00650  Butanoate metabolism
cmai00900  Terpenoid backbone biosynthesis
cmai01100  Metabolic pathways
cmai01110  Biosynthesis of secondary metabolites
cmai01120  Microbial metabolism in diverse environments
cmai01130  Biosynthesis of antibiotics
cmai01200  Carbon metabolism
cmai01212  Fatty acid metabolism
cmai02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cmai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BFX80_16410
   00630 Glyoxylate and dicarboxylate metabolism
    BFX80_16410
   00640 Propanoate metabolism
    BFX80_16410
   00650 Butanoate metabolism
    BFX80_16410
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BFX80_16410
   00072 Synthesis and degradation of ketone bodies
    BFX80_16410
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BFX80_16410
   00310 Lysine degradation
    BFX80_16410
   00380 Tryptophan metabolism
    BFX80_16410
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BFX80_16410
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BFX80_16410
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BFX80_16410
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmai04147]
    BFX80_16410
Enzymes [BR:cmai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BFX80_16410
Exosome [BR:cmai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BFX80_16410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AOM02546
UniProt: A0A1C9BJ23
Position
3971630..3972811
Genome map
AA seq 393 aa AA seqDB search
MQDVVIVAARRTAVGAFGGSLAGISAADLGAHVIKDILASTGVSGDQVDEVLLGQVLTAG
CGQNPARQTVIKAGLPEGVPAMTINKVCGSGLKALHLATQAIRCGDAQLILAGGQENMSL
SPHVLPNSRNGKRMGDWKAIDTMVHDGLWDAFNDIHMGITAENLAEKYEITREAQDAFAA
ASQQKACEAIEAGRFKSQIVPVEIPQRKGDPIVFDTDENPRAGTTAEKLAGMRPAFKKDG
TVTAGNASALNDGAAVVMLCSADKARELGLTPLATIKAYSNAGVDPKIMGIGPAPATRLC
LKKAGWSLEDLDLVEANEAFAAQALSVNKELGWDVDKVNVNGGAIALGHPIGASGCRVLV
TLVHEMIARDAKKGLATLCIGGGQGVALAIERS
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatgtggtgatcgtagcagctcgtcgtaccgccgtaggtgccttcggtggcagc
ctcgccggcatttccgccgctgacctcggggcacatgtcatcaaggatatcctcgccagc
acaggggtgagcggtgatcaggtcgacgaagttctgctcggccaggtgctgacggcaggc
tgcggccagaatccggctcgtcagaccgtcatcaaggcaggcctgccggaaggcgtgccg
gcgatgaccatcaacaaggtctgtggctctggcctgaaggcactgcatctggccacccag
gccatccgctgtggcgatgcccagctgattctggccggcggtcaggagaacatgtcactg
tctcctcatgtgctgcccaactcccgcaatggcaagcgcatgggcgactggaaggcgatc
gacaccatggtccacgacggactttgggatgccttcaatgatatccacatgggcatcacc
gccgagaacctggcagagaagtacgagatcacccgcgaagcgcaggatgccttcgctgcc
gcatcccagcagaaggcctgcgaggccatcgaggcgggccgcttcaagagccagatcgtt
ccggtcgagattccgcagcgcaagggcgacccgatcgtcttcgacaccgacgagaacccg
cgtgccggcaccactgccgagaaacttgccggcatgcgtccagccttcaagaaggatggt
accgtcaccgcaggcaacgcctcggcgctcaatgatggtgccgccgtggtcatgctatgt
tccgccgacaaggcccgcgaacttggcctgacgccgctggcgaccatcaaggcgtactcc
aacgccggtgtcgacccgaagatcatgggcatcgggccggctcccgccacccgcctgtgc
ctcaagaaggccggctggagcctggaagatctcgatctcgtcgaagccaacgaagccttc
gccgcccaggcgctctccgtcaacaaggagctgggctgggatgtcgacaaggtcaacgtc
aatggcggtgccatcgcgctgggccacccgatcggggcatccggctgccgtgtactggtc
acgctggtacacgagatgatcgcccgcgatgccaagaagggtctggcgaccctgtgcatc
ggcggcggccagggtgtcgcactggccatcgagcgcagctga

DBGET integrated database retrieval system