KEGG   Cobetia marina: BFX80_16775Help
Entry
BFX80_16775       CDS       T04789                                 

Definition
(GenBank) hypothetical protein
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
cmai  Cobetia marina
Brite
KEGG Orthology (KO) [BR:cmai00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cmai03009]
    BFX80_16775
Enzymes [BR:cmai01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     BFX80_16775
Ribosome biogenesis [BR:cmai03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BFX80_16775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 Ubie_methyltran Methyltransf_23 Methyltransf_12 Methyltransf_32 Methyltransf_8 MetW MTS
Motif
Other DBs
NCBI-ProteinID: AOM03277
Position
complement(4050615..4051484)
Genome map
AA seq 289 aa AA seqDB search
MTPLTTLTCPLDAQRLMRDGQSWCCADGHRFDIARQGHVNLLPVQRKRSLDPGDSKAMVS
ARQRLFALGGYQPLASALARRVLALAGQASALAVLDAGCGEGFYLRQLAGAADEQQRSLT
AAGLDISKHAVLAAAKQSRDAAWLVGTNAALPLEDACVDVVICAFGFPVWQEFARVLKPG
GHVVLLEAGAEHLLALRRILYRELKPARGEAGVMAAEAAGFVVEGEVEHLHAGLSLTSNE
QIRDLLTMTPHLYRAERDGLARAEAMTALAVELHAELRVFTREEAQGAA
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgacgccactgacgaccctgacctgtccactggatgcccagcggctgatgcgagatggc
cagagctggtgctgcgccgatggccatcgcttcgatatcgcgcgtcaggggcacgtcaat
ctgctgccggtgcagcgcaagcgcagtctagaccccggcgacagcaaggcgatggtcagc
gctcgccagcggctgttcgccctcggtggctatcagcctctcgcctcggcgctggcacga
cgtgtgctggcgctggcagggcaggcaagtgcgctggccgtgctggatgccggctgtggg
gaaggcttctatctgcgtcagctggcaggcgctgccgatgagcagcagcgctcgctgacg
gcggcgggactggatatctccaagcacgcggtgctggcggcagcgaagcagtcacgcgat
gccgcctggttggtgggcaccaacgcggcactgccgttggaagacgcctgtgtggatgtg
gtgatctgcgccttcggcttccccgtctggcaggagttcgcgcgtgtgctcaagcccggg
ggccatgtggtgctgctggaggcgggagccgagcacctgctggcgttgcgcagaattctc
taccgggagctgaagcccgcgcgtggcgaggccggggtgatggccgccgaagctgcaggt
ttcgtggtggagggggaggtcgagcatctgcatgcagggctttcattgaccagcaatgag
cagatccgggatctgctgaccatgaccccgcatctgtatcgtgccgagcgtgatggtctg
gcacgagccgaagctatgacggccttggcggtcgagctgcacgcggaactgagggtgttc
acgcgagaggaggcacaaggcgcggcgtaa

DBGET integrated database retrieval system