KEGG   Croceicoccus marinus: A9D14_00390Help
Entry
A9D14_00390       CDS       T04890                                 

Definition
(GenBank) NADP-dependent 3-hydroxy acid dehydrogenase
  KO
K05886  serine 3-dehydrogenase (NADP+) [EC:1.1.1.276]
Organism
cman  Croceicoccus marinus
Brite
KEGG Orthology (KO) [BR:cman00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A9D14_00390
Enzymes [BR:cman01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.276  serine 3-dehydrogenase (NADP+)
     A9D14_00390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase LDcluster4 Polysacc_synt_2 RmlD_sub_bind F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ARU17131
UniProt: A0A1Z1FE89
Position
70729..71481
Genome map
AA seq 250 aa AA seqDB search
MKTVLVTGATAGIGEACARAFANAGWRVVGTGRRVERLQALQDELGAERFQPCVFDIRDE
AARDKALDDLPEAFGQIDCLVNNAGLALGTQPAQDSDLDQWKVMIDTNVTALVSLTRRLL
PMLVERKGAIVNLSSVAANYPYTGGNVYGGTKAFVRQFSLGLRSDLHGTGVRVTSIEPGM
VETEFTVVRTGGSQQASDALYGGANPMTGGDIAETILWVASLPPHLNINTLELMPVSQSF
AGFQVARDEK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccgtccttgtgaccggagcgaccgccggtatcggcgaagcctgtgcccgcgcc
tttgcgaacgccggttggcgcgtggtcggcaccgggcgccgcgtggagcggctgcaggcg
ctgcaggatgagctgggcgcggagcgtttccagccctgcgtgttcgacatccgcgacgag
gctgcgcgcgacaaggcgctggacgatctgcccgaggcgttcggacagatcgactgcctg
gtgaacaatgccgggctggcgctgggaacccagccggcgcaggacagcgatctggaccag
tggaaggttatgatcgacaccaatgtcaccgcgctggtgtcgctgacccgcaggctgctg
ccgatgctggtcgagcgcaagggcgcgatcgtcaacctgtcctcggtcgcggcgaattat
ccctatacgggcggtaacgtgtatggcgggaccaaggcgttcgtgcgccagttctcgctg
ggcctgcgcagcgacctgcatggcacgggcgtgcgcgtgaccagcatcgagcccggcatg
gtcgagaccgaattcaccgtggtgcgcaccggcggcagccagcaggcgagcgatgcgctg
tatggcggggccaatccgatgacgggcggggacatcgccgagacgatcctgtgggtggca
agcctgcccccgcatctcaacatcaatacgctggaactgatgccggtaagccagagcttt
gccgggtttcaggtcgcgcgcgacgaaaagtag

DBGET integrated database retrieval system