KEGG   Croceicoccus marinus: A9D14_00965Help
Entry
A9D14_00965       CDS       T04890                                 

Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
cman  Croceicoccus marinus
Pathway
cman00360  Phenylalanine metabolism
cman00362  Benzoate degradation
cman00621  Dioxin degradation
cman00622  Xylene degradation
cman01100  Metabolic pathways
cman01120  Microbial metabolism in diverse environments
cman01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cman00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    A9D14_00965
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A9D14_00965
   00622 Xylene degradation
    A9D14_00965
   00621 Dioxin degradation
    A9D14_00965
Enzymes [BR:cman01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     A9D14_00965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm DUF3866
Motif
Other DBs
NCBI-ProteinID: ARU15005
UniProt: A0A1Z1F8E4
Position
175799..176827
Genome map
AA seq 342 aa AA seqDB search
MSFDPAVDKLYIQDVTLRDGMHAIRHKYGIDHVRAIAAALDAAKVDAIEVAHGDGLNGSS
FNYGFGAHTDWEWIEAVADVLRHSVLTTLLIPGIGTIEELKHAYSLGVRSVRVATHCTEA
DISKQHIEAARNLDMDVSGFLMMSHMSEPDALAGQAKLMEDYGAHCVYVTDSGGAMDMDD
YRARLAAYDRVLKPETQRGIHAHHNLSLGVANSMVGAQAGAVRIDASLAGMGAGAGNAPL
EVFIAAADRKGWKHGCDLYALMDVAEELVRPLQDRPVRVDRETLSLGYAGVYSSFLRHAE
KASEDYGVDTRRILVELGRRRMVGGQEDMIVDVALDLAKSGD
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcgatccggcagtagacaagctctacatccaggacgtgacgcttcgcgatggc
atgcacgcgatccgtcacaaatacggtatcgaccacgtgcgcgccattgctgcggcactc
gacgctgccaaggtcgatgccatcgaagtcgcccacggcgacggtctcaacggttcgtcc
ttcaactatggtttcggtgcccacaccgattgggaatggatcgaggcggtggccgacgtg
ctccggcactcggtgctcactaccttgctgatcccgggtatcggcaccatcgaggaattg
aagcacgcctactcgcttggcgtacggtcggtacgggtagcgacgcattgcacagaggcc
gacatctcgaagcagcatatcgaggcggcccgcaaccttgacatggacgtatcgggcttc
ctgatgatgagccacatgagcgagccggatgccctggccggacaggcgaagctgatggaa
gattacggcgcgcattgcgtctatgtaaccgacagcggcggcgcgatggacatggacgat
taccgcgcgcggcttgcggcctacgatcgtgttctgaaacccgagacgcagcgcggaatc
cacgctcaccacaacctctcgcttggcgttgccaattcaatggtcggcgcacaggccgga
gccgtccggatcgacgccagcctggctggcatgggcgccggggccggaaacgctccgctg
gaggtgttcatagccgcggccgatcgcaaggggtggaagcacgggtgcgatctctacgcc
ctgatggatgttgccgaagaactcgtcaggccactgcaggacaggccggtgcgcgtcgat
cgcgagacgttgagccttggttatgcgggcgtctattccagcttcctgcgccatgcggaa
aaggcgagcgaggattatggggtcgatacgcggcgaatcctcgtcgaactcggccgcagg
cgaatggttggcgggcaggaggacatgatcgtcgatgtcgccctggatctggcaaagtca
ggtgactga

DBGET integrated database retrieval system