KEGG   Croceicoccus marinus: A9D14_04005Help
Entry
A9D14_04005       CDS       T04890                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
cman  Croceicoccus marinus
Brite
KEGG Orthology (KO) [BR:cman00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    A9D14_04005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4962
Motif
Other DBs
NCBI-ProteinID: ARU17231
UniProt: A0A1Z1FEI7
Position
828749..829150
Genome map
AA seq 133 aa AA seqDB search
MEQLFDHAAISHGITVRVSASFLPEQSQVSEGHWFWAYHIRIENGGDQPARLLTRHWRIT
DAAGRISLIDGDGVVGEQPLLHPGESHDYVSGCPLETPHGSMEGYYGFRREDGTVFEAAI
PFFPLSAPATAQR
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atagagcagctattcgatcatgccgcgatatcgcacggcatcactgtccgggtcagcgca
agcttcctgccggaacagtcgcaggtgtcggaaggacactggttctgggcctatcacatc
cggatcgagaacggcggcgaccagcccgcccgcctgctgacccgccactggcgcatcacc
gatgccgctggccgcatcagcctgatcgacggcgacggcgtggtgggcgaacagcccctg
ctgcatcccggcgaaagccacgactatgtctcgggctgcccgctggaaacgccgcacggc
tcgatggaaggctactatggcttccgccgcgaggacggcaccgtgttcgaagccgcgatc
cccttcttcccgctgtcggcacctgccaccgcgcagcggtaa

DBGET integrated database retrieval system