KEGG   Croceicoccus marinus: A9D14_05820Help
Entry
A9D14_05820       CDS       T04890                                 

Definition
(GenBank) aldehyde dehydrogenase (NADP(+))
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
cman  Croceicoccus marinus
Pathway
cman00040  Pentose and glucuronate interconversions
cman00053  Ascorbate and aldarate metabolism
cman01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cman00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    A9D14_05820
   00053 Ascorbate and aldarate metabolism
    A9D14_05820
Enzymes [BR:cman01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     A9D14_05820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA IF-2B
Motif
Other DBs
NCBI-ProteinID: ARU15789
UniProt: A0A1Z1FAF2
Position
complement(1210709..1212238)
Genome map
AA seq 509 aa AA seqDB search
MTEFRSVVAETGEAHGDPLTVHGPEDVAAACAAADAAFDTYRATSNEERAAFLERIADEI
MGIGDELIEAYTRESGLPKGRAEGERGRTCGQMKMFADVVRKGQWEQIRIDPAMPDRQPL
PRPDLRLRMIPVGPVAIFGASNFPLAFSTAGGDTASALAAGCPVVVKGHPAHPHTGGLVA
DAISRAVKASGLPEGVFQHLSGPSNELGAALVQDPHIMAVGFTGSRAGGLALAKLAQERP
VPIPVYAEMSSINPVILLPHALKARGSDLGTAFVGSLTMGAGQFCTNPGLVLAIEGDGIE
DFITAATGGVSESKPQTMLTKGIASAYAKGLEVLSGLPGVDMLAKGEEGSVTTGGTALFQ
TSAEKFLAEPKIAHEVFGSSSVIVRCKDEAELKQVLEAVEGQLTATLHMDDADQAAAGRL
VPVLERRVGRILVNGWPTGVEVCHAMVHGGPFPSTTDPRTTSVGSLAIDRFLRPVSYQNF
AQGLLPPELRDDAKGDGVPRLVDGKLTVS
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgactgaattccgatccgtggttgccgaaaccggcgaagcccatggcgaccccctcacc
gtccatgggcccgaagatgtcgcggcggcctgcgccgctgccgacgccgcattcgacacc
tatcgcgcgaccagcaacgaggagcgcgccgcgttcctcgagcgaatcgctgacgaaatc
atgggcatcggcgacgagctgatcgaagcctacacccgcgaaagcggcctgcccaagggc
cgtgccgaaggcgagcgtggtcgcacctgcggccagatgaaaatgttcgccgatgtcgtg
cgcaagggccagtgggagcagatccgcatcgatcccgccatgcccgaccgccagcccctg
ccccgcccggacctgcgcctgcgcatgatcccggtcggtccggtggcgatcttcggcgcg
tcgaacttcccgctcgccttctcgaccgcgggcggcgacaccgcctcggcgctggcggcg
ggctgcccggtcgtggtcaagggccaccccgcgcacccccacaccggcgggcttgtcgcc
gatgcgatcagccgggcggtcaaggcaagcggactgcccgaaggcgtgttccagcacctg
tccggcccctcgaacgagctgggcgccgcgctggtgcaggatccgcacatcatggcggtc
ggcttcaccggctcgcgcgcgggcggcctggcgctggccaagctggcacaggaacgtccc
gtgccgatcccggtctatgccgagatgtcgagcatcaatcccgtcatcctgctgccgcat
gcgctgaaggcacgcggttccgacctgggcaccgccttcgtcgggtcgctgacgatgggt
gcgggccagttctgcaccaatcccggcctggtccttgcgatcgagggcgacggtatcgag
gatttcatcaccgcggccactggcggcgtgtcggaatcgaagccgcagaccatgctgacc
aaggggatcgcttccgcctatgccaaggggctggaagtcctgtcgggcctgcccggcgtc
gacatgctggccaagggcgaggaaggcagcgtcaccaccggcggcaccgccttgttccag
acttcggccgagaagttcctggccgagccgaagatcgcgcacgaggtgttcggttcctcg
tcagtcatcgtccgctgcaaggacgaggcggagctgaagcaggtgctcgaggccgtcgaa
ggccagctcaccgcgacgctgcacatggacgatgcggaccaggctgctgccggacgcctc
gttcccgtgctggaacgccgcgtcgggcgcatcctggtcaatggctggcccaccggggtc
gaggtctgccacgcgatggtgcatggcggtccgttcccctcgaccaccgatccgcgcacg
acatcggtcggcagccttgccatcgaccggttcctgcgtccggtaagctaccagaacttc
gcgcagggcctgcttccgcccgaactgcgcgacgatgccaagggtgacggcgtgccgcgc
ctggtcgacggcaagcttaccgtcagctga

DBGET integrated database retrieval system