KEGG   Croceicoccus marinus: A9D14_07145Help
Entry
A9D14_07145       CDS       T04890                                 

Definition
(GenBank) 1,4-beta-D-glucan glucohydrolase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
cman  Croceicoccus marinus
Pathway
cman00460  Cyanoamino acid metabolism
cman00500  Starch and sucrose metabolism
cman01100  Metabolic pathways
cman01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cman00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A9D14_07145
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    A9D14_07145
Enzymes [BR:cman01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     A9D14_07145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C Exop_C
Motif
Other DBs
NCBI-ProteinID: ARU16007
UniProt: A0A1Z1FBE6
Position
1487045..1489558
Genome map
AA seq 837 aa AA seqDB search
MISFRATSIAVTAALLAGCAAVPADMELRQPPLADGGDGPGIAHPEIWPAYDYPVPANPQ
AEQRIADLLNRMTLEEKIGQLVQADLCCVTPEDVRRYNLGSILVGGNSGPGGDDLAPAPE
WLKAADEFYLASVDRSDGGVGVPLVWGTDAVHGHSNIVGATIFPHNIGLGAMRDPSLVEK
IGAVTAKEIRVTGQEWTFAPTVAVPQDFRWGRAYEGYSSDPELVASYVGAMVRGLQGPPT
NDNLLAGPHVIASTKHFLADGGTDRGVDQGDSSIDEETLRDIHGLPYGPAIGEGVATVMV
SFSSWQGRKMTGNRSLVTDVLKDRMDFGGFVVSDWNAHGQVEGCTNESCPEALTAGIDMY
MAPDTWKPIYEDLLARARSGEVSMERIDEAVARILRVKMRLGLFEAGKPSDRPLSGDYDL
LGAPEHREVARQAVRQSMVLLKNQGVLPLRPGGRLLVAGDGADDIARQSGGWTLSWQGTG
IDNSDFPGATSIFSGLKQTVEAGGGTAQLSPDGSFSERPDAAIVVFGEKPYSEFQGDRAT
LALDPELTAPYETMRKLKAQGIPVVALMLTGRPLYVNPALNMADAFVVAWLPGSEGGGVA
DVLVGNAAGQPRHGFTGKLPAAWPQTPAMEDGVLFPFGYGLTYGTAAQGWTPLPEIAVTE
TSDTRSWFTAGSPASGWSLLVGGEEGDVQTRVTTVPAEALRGRVRVTATDYLVQEGGRRF
TIADGDASVLLRNFEPVNVDRETNGDVKLLFTLRVWDAPDSASIGAGGESGRGAVSFDMQ
QSSEWRRYGIPLKCLRAQGADVTELTLPFILRTQGTADYALGEVRLGTDAEVDVPCS
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atgatcagttttcgcgcgacatccatcgctgtcaccgcagcgctgctggcgggctgcgcc
gccgttccggccgatatggagctgcgccagccgccacttgccgacggcggcgacggcccg
ggcatcgcccacccggaaatctggcccgcctatgattatccggtacccgccaatccgcag
gcggagcagcgcattgccgatctgctgaaccggatgacgctggaggaaaagatcggccag
ctggtccaggccgacctgtgctgcgtcacgcccgaggatgttcgccgctataatctggga
tcgatcctggtgggcggcaacagcggtcccggcggcgacgatctggcgcccgcgcccgaa
tggctgaaggcggcggacgagttctacctcgcctcggtcgaccggtccgacggcggtgtg
ggcgttccgctggtctggggcaccgacgcggtgcacggccattcgaacatcgtcggcgcg
acgatattcccgcacaacatcgggcttggcgcgatgcgcgacccttcgctggtcgagaag
atcggcgcggtcaccgccaaggagatccgcgtcaccgggcaggaatggacctttgcgccc
accgttgccgtcccgcaggatttccggtggggccgcgcctatgaaggctattcctccgat
ccggaactggtcgcttcctatgtcggcgcgatggtgcgcggcctgcaggggccgcccacg
aacgacaatctgctggccggtccccatgtgatcgcgtcgaccaagcatttcctggccgat
ggcggcaccgaccgcggcgtcgaccaaggcgattcctcgatcgacgaggagacgctgcgc
gacattcacggtctgccctacggccccgccatcggcgagggcgtggcgaccgtgatggtc
agcttctcgtcctggcagggacgcaagatgaccggcaatcgcagcctcgtcaccgatgtg
ctgaaggatcgcatggatttcggcggcttcgtcgtgtcggactggaacgcgcatgggcag
gtcgagggctgcaccaacgaaagctgtcccgaggcgctgaccgccgggatcgacatgtac
atggcgcccgacacctggaagccgatctacgaggatctgcttgcccgcgcccggtccggc
gaagtttcgatggagcgcatcgacgaggcggtcgcccgcatcctgcgcgtcaagatgcgg
ctgggcctgttcgaggctggcaagccgtcggatcgcccgctgtcgggcgactacgatctg
ttgggcgcccccgaacatcgcgaagtggcgcggcaggcggtgcgccagtcgatggtgctg
ctgaagaaccagggcgtattgccgctgcgtcccggcgggcggctgctggtcgcgggcgac
ggcgccgacgacatcgcgcgccagtcgggcggctggaccctgtcgtggcagggcaccggg
atcgacaacagcgatttccccggcgcgacctcgatcttcagcgggctgaagcagaccgtc
gaggccggcggcgggacggcgcagctgtcccccgacggcagcttcagcgaacggcccgat
gcggcgatcgtggtgtttggcgagaagccctactccgaattccagggcgaccgcgcgacg
ctggccctggatcccgagctgactgccccttacgaaaccatgcgcaagctgaaggcgcag
ggcatcccggtcgtggcgctgatgctgaccggccggccgctctatgtgaacccggcgctg
aatatggcggatgccttcgtggtcgcctggctgccgggcagcgagggcggcggcgtcgcc
gacgtgctggtcggcaatgccgcgggccagccacgccacggctttacgggcaagctgccc
gccgcctggccgcagacccccgcgatggaggacggcgtgctgtttcccttcggctatggc
ctgacatatggcacggccgcgcagggctggacgcccctgcccgagatcgccgtgaccgaa
acgagcgacacgcggtcctggttcaccgcgggcagccccgcatcgggatggtcgctgctg
gtcgggggtgaggaaggcgacgtccagacgcgcgtcacgaccgtccccgcagaagcgctg
cgcggacgggtgcgcgtgaccgcgaccgactatctggtccaggaaggcggccgccgcttt
accatcgcggacggcgatgcctcggtcttgctgcgcaatttcgaaccggtgaatgtcgac
cgcgagaccaatggcgacgtgaagctgctgttcaccctgcgcgtatgggatgcgcccgac
agcgccagcatcggcgcaggcggcgaaagcggccgcggagccgtgtcgttcgacatgcag
cagagcagcgagtggcggcgctatggcatcccgctcaaatgcctgcgcgcgcagggtgcc
gacgtgaccgagctgacgctgcccttcatcctgcggacgcagggcaccgcggattacgcg
ctgggcgaagtgcggctcggcaccgatgccgaagtggacgtgccctgttcgtga

DBGET integrated database retrieval system