KEGG   Croceicoccus marinus: A9D14_09095Help
Entry
A9D14_09095       CDS       T04890                                 

Definition
(GenBank) siroheme synthase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
cman  Croceicoccus marinus
Pathway
cman00860  Porphyrin and chlorophyll metabolism
cman01100  Metabolic pathways
cman01110  Biosynthesis of secondary metabolites
cman01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cman00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A9D14_09095
Enzymes [BR:cman01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     A9D14_09095
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     A9D14_09095
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     A9D14_09095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 CysG_dimeriser TP_methylase Peptidase_M17_N PALP
Motif
Other DBs
NCBI-ProteinID: ARU16320
UniProt: A0A1Z1FC35
Position
complement(1912451..1913236)
Genome map
AA seq 261 aa AA seqDB search
MAVNSLPLFHRIADRRVVVLGLGEAAEAKRRLVERAGGICVGEAEAHHAQLAFVVLDDEG
EARAAAMRLRGKGLIVNVTDRPALCDFTVPSIVDREPVIVAVGTGGASAGMAKMLRLRLE
RFLPQGLGRLASQLSAARPAIRARFPTSDQRRRALDAALREGGPLDPMAVQGEDAVDRWL
SGDRNDTEQGFFQILLRSADPDDLTLREARLLGGADVVIHDRNVPQSVLVRARADAQRVP
EGGEVPADMADGIVVAIRSAN
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
ctggctgtgaactcgctgccgctcttccaccgcatcgccgatcgcagggtcgtggtgctg
ggcctgggcgaggctgccgaagccaagcgccgcctggtcgaacgggcaggcggcatctgc
gtgggcgaggctgaggcacatcacgcccagctcgccttcgtggtgctggatgacgagggc
gaggccagggccgcggcgatgcggctgcgcggcaaggggctgatcgtcaacgtgaccgac
cggcccgcgctgtgcgatttcaccgtcccgtcgatcgtcgaccgcgaaccggtgatcgtg
gcggtcggcaccggcggcgcgtcggcaggcatggccaagatgctgcggctgcggcttgag
cgcttcctgccgcagggcctcggccggctggcgtcgcaattgtccgccgcgcgcccggcg
atccgcgcgcgctttccgacatccgaccagcggcgccgcgcgctcgacgcggcgctgcgc
gaaggcggcccgctcgacccgatggcggtacagggcgaggacgcggtcgatcgctggctg
tcgggcgacaggaacgataccgagcaggggtttttccagatcctcttgcggtcagccgat
cccgacgaccttaccttgcgcgaagcgcggcttctgggcggcgcggatgtggtcattcat
gaccgcaacgtgccacaatcggtgctggttcgtgcccgcgccgacgcgcagcgcgtgccg
gaaggcggagaggttccggcggacatggcggacggcatcgtggtggcgatccgatcggca
aattaa

DBGET integrated database retrieval system