KEGG   Croceicoccus marinus: A9D14_16180Help
Entry
A9D14_16180       CDS       T04890                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cman  Croceicoccus marinus
Pathway
cman00071  Fatty acid degradation
cman00072  Synthesis and degradation of ketone bodies
cman00280  Valine, leucine and isoleucine degradation
cman00310  Lysine degradation
cman00362  Benzoate degradation
cman00380  Tryptophan metabolism
cman00620  Pyruvate metabolism
cman00630  Glyoxylate and dicarboxylate metabolism
cman00640  Propanoate metabolism
cman00650  Butanoate metabolism
cman00900  Terpenoid backbone biosynthesis
cman01100  Metabolic pathways
cman01110  Biosynthesis of secondary metabolites
cman01120  Microbial metabolism in diverse environments
cman01130  Biosynthesis of antibiotics
cman01200  Carbon metabolism
cman01212  Fatty acid metabolism
cman02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cman00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A9D14_16180
   00630 Glyoxylate and dicarboxylate metabolism
    A9D14_16180
   00640 Propanoate metabolism
    A9D14_16180
   00650 Butanoate metabolism
    A9D14_16180
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A9D14_16180
   00072 Synthesis and degradation of ketone bodies
    A9D14_16180
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A9D14_16180
   00310 Lysine degradation
    A9D14_16180
   00380 Tryptophan metabolism
    A9D14_16180
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A9D14_16180
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A9D14_16180
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A9D14_16180
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cman04147]
    A9D14_16180
Enzymes [BR:cman01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A9D14_16180
Exosome [BR:cman04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A9D14_16180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt UPF0731 ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ARU18162
UniProt: A0A1Z1FHD1
Position
pCME4A9I:complement(419015..420223)
Genome map
AA seq 402 aa AA seqDB search
MREAVIVSTARTPVGKAHRGAFNATMPDVLAAHAMNAAIDRAGIDPARIDDVMWGAGGQF
GPQFYNVGRMSLFTAGLPQELPAFTLDRKCASGLTTVALAARSIIAGDADVVLAGGSESI
STTLGQPPIAGPHWRSPTVSEAEPDAYMAMIETAEIVAERYGISREAQDEFSATSQQRAA
DATRAGRLADEIVPITVEKILRAKDGTETGRETLTVSADEGIRADTTAEALSALKPVWKD
GMKVKEGRFVTAGNASQLSDGAAAQIVMDRAAAEAEGREVLGIFRGFQAAGCAPDEMGIG
PVFAIPKLLDRARLTIADIGLWEINEAFASQALYCRDRLGIDPDRLNVNGGAIAIGHPFG
MTGSRLVGAALLEGRRRNVRHVVVSMCVAGGMGAAGLFEIPS
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaagccgtcatcgtttcgaccgcccgcacgcccgtcggcaaggcgcatcgcggc
gcgttcaatgcgaccatgcccgatgtgctggccgcgcatgcgatgaatgccgcgatagac
cgtgccgggatcgatcccgcgcgcatcgacgacgtcatgtggggtgcaggcgggcagttc
ggtccgcagttctacaatgtcgggcgcatgagcctgttcaccgcgggcctgccgcaggaa
ctgcctgcgttcacgctggaccgcaaatgcgcgtcgggcttgaccacggtggcgctggca
gcgcgcagcattatcgcgggggatgccgacgtggtgttggcaggcggatcggaatcgatc
tccaccaccctgggccagccgcccatcgcggggccgcactggcgttcccccaccgtgagc
gaggccgagcccgacgcctatatggcgatgatcgagactgccgagatcgtggccgaacgc
tatggcatcagccgcgaggcgcaggacgaattttccgccaccagccagcagcgcgccgcc
gatgcgacccgggcgggcaggttggcggacgaaatcgtgccgatcacggtcgaaaagatc
ctgcgcgcgaaggacgggaccgaaacggggcgcgagacgctgaccgtcagcgccgacgaa
ggcatccgcgccgacaccacggccgaggcgctctccgcgctgaagccggtgtggaaggac
gggatgaaggtgaaagaaggccgcttcgtcaccgctggaaacgccagccagctatccgac
ggcgccgccgcgcagatcgtgatggaccgcgcggccgccgaggccgagggacgcgaggtg
ctgggcatctttcgtgggttccaggctgcgggctgcgcgcccgacgagatgggcatcggg
ccggtcttcgcgatccccaaactgctggaccgcgcaaggctgacaatcgccgacatcggg
ctgtgggagatcaacgaggccttcgccagccaggcgctctattgccgcgaccggctgggg
atcgatcccgaccggctcaacgtcaatggcggcgccatcgccatcggccaccccttcggc
atgaccggatcgcgtctggtcggcgcggcgctgctggaagggcggcggcgcaatgtgcgc
catgtggtcgtttccatgtgcgtggcgggcggcatgggcgcggccggacttttcgaaatc
ccctcatga

DBGET integrated database retrieval system