KEGG   Celeribacter marinus: IMCC12053_1851Help
Entry
IMCC12053_1851    CDS       T04098                                 

Definition
(GenBank) DNA-binding response regulator PetR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
cmar  Celeribacter marinus
Pathway
cmar02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cmar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    IMCC12053_1851
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cmar02022]
    IMCC12053_1851
Two-component system [BR:cmar02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   IMCC12053_1851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ALI55798
UniProt: A0A0P0AAR7
Position
1820995..1821693
Genome map
AA seq 232 aa AA seqDB search
MKSDIHLLIVDDDERIRDLLKKYLMRHGFCVTAARDAAHARRILAGLEFDLIVLDVMMPG
EDGISLTRDLRLRIATPIMLLTAKGETEDRISGLEAGADDYLAKPFEPKELLLRINAVLR
RVPDEEPAVQVPKHLRLGLFRYDVERGELWHGDAPLRLTATENQLMRIFAATPSVAVSRT
DLVERLGRDGGQAQERAVDVQITRLRRKLEIDPRQPRYLQTVRGEGYMLVPE
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaagtgatattcatcttttgatcgttgatgacgatgagaggattagggatctcctg
aaaaagtatctgatgcggcatgggttttgtgtcacggcggcgcgagacgcggcgcatgca
cggcgtattttggcgggtttggagttcgacctgatcgtccttgatgtgatgatgcccggc
gaggatggtatttcactgacgcgcgatttgcgcctacgcattgcaacgcccatcatgctt
ttgaccgcgaaaggcgagaccgaagataggatttcgggacttgaggcgggcgcagacgat
taccttgcaaaaccgtttgagcctaaggaattgttgcttcgtatcaatgctgttttgcgg
cgtgttcccgacgaagagccggcggtgcaggtgccaaaacacctgcgtttgggtctattt
cgctatgatgttgagcgtggagagctttggcatggagacgcgcctttacggctcaccgcc
accgaaaaccaattgatgcgcatatttgcggcgaccccaagtgtcgctgtctcgcgcacg
gatttggtggagcgtttggggcgagatggcggtcaggcacaagagcgggccgtggacgtc
caaatcacgcgattgcgccgaaagttggagatcgatccacgtcaaccgagatacctgcaa
actgtacgcggcgagggctatatgctcgttcccgaatag

DBGET integrated database retrieval system