KEGG   Celeribacter marinus: IMCC12053_2761Help
Entry
IMCC12053_2761    CDS       T04098                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
cmar  Celeribacter marinus
Pathway
cmar00620  Pyruvate metabolism
cmar00630  Glyoxylate and dicarboxylate metabolism
cmar01100  Metabolic pathways
cmar01110  Biosynthesis of secondary metabolites
cmar01120  Microbial metabolism in diverse environments
cmar01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cmar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    IMCC12053_2761
   00630 Glyoxylate and dicarboxylate metabolism
    IMCC12053_2761
Enzymes [BR:cmar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     IMCC12053_2761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ALI56708
UniProt: A0A0P0A7G9
Position
2697134..2699296
Genome map
AA seq 720 aa AA seqDB search
MTSDTAQTNLETRHGLQVNTDLARFIEAEALPETGVAADAFWSGLSALVHEFGDTNRSLL
EKREDLQRQIDQWHIARRGMAHDETAYKAFLSDIGYLLEEGEDFKIETANVDPEIATIAG
PQLVVPITNARFVLNAANARWGSLYDGFYGTDAMGSLPKPGPFDQGRGARVVARAGVFLD
EAFTITGTSHGKAQQYAVIDGALIIDGSPLVDPDKFVGFTGDAADPSSVVLCNHGLHVEL
VFDRAHPIGKTTPSGLADVRLESAISAIIDCEDSVACVDAEDKIVAYRNWLGLMKGDLSE
TFEKGGKSVTRALNADHTYTGRDGTPAALKGRALLLVRNVGHLMTNPAILDREGREIFEG
LMDAMITSLIAMHDLKKTDGLRNSTHGSVYVVKPKMHGPEEVAFADQIFSHVERVLGLPQ
YTVKLGIMDEERRTSVNLKECIRAAKSRVAFINTGFLDRTGDEIHTSMEAGPFSRKDFIK
RKGWITAYEDQNVDIGLECGLSGKAQIGKGMWAVPDKMADMLSAKIAHPKSGANCAWVPS
PTAATLHALHYHQVDVFAVQDKLAKGGRRAHVDAVLDIPIAQYRRWTKDQITREIENNAQ
GILGYVVRWINQGVGCSKVPDINDVGLMEDRATCRISAQHIANWLHHNVASHAQVMDIMK
KMAAVVDRQNENDPSYTPMTPALDGIAFQAACDLVFKGREQPSGYTEPVLHVRRLELKAQ
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgaccagtgacaccgcccagaccaaccttgaaacccgccacggattgcaagtgaacact
gatcttgcccgctttatcgaagccgaagctctccccgaaacgggtgttgcggctgatgcg
ttttggtcgggcctgtccgcattggtacatgagtttggcgacacaaaccgcagcctgctt
gagaaacgcgaagacctacaacgccagatcgaccaatggcacatcgcgcggcgcgggatg
gcgcatgatgaaaccgcctacaaagcctttttgagtgatatcggataccttcttgaggaa
ggggaagatttcaagatcgagacggcaaatgtcgaccccgagattgcaaccatcgccggt
ccgcaacttgtcgttcccatcaccaatgcccgctttgtcttgaacgccgccaacgcacgt
tggggcagcctttacgatgggttctacggcacggacgcaatggggtcgctaccaaagcct
ggcccattcgaccaagggcgcggcgcgcgcgttgttgctcgcgcaggcgtctttttggac
gaggcatttaccatcacaggcacaagccacggtaaggcccaacagtacgccgtgattgat
ggtgcgctcattattgatggctccccgcttgttgatcccgacaaattcgtaggcttcaca
ggtgacgccgctgacccgtcatctgttgtcttgtgcaaccacgggcttcacgtcgaactg
gtgttcgaccgcgcgcatccgattggcaaaaccaccccatctggcttggccgatgtacgc
cttgaatccgcgatatccgcgatcatcgactgtgaggattcagtggcttgcgtcgatgcc
gaagacaagattgtcgcctatcgcaactggcttggcctgatgaagggtgatctatccgag
acctttgaaaagggcggcaaatccgtcacccgcgcgctcaacgccgatcatacctacact
ggccgtgacgggacgccggcagccctaaaaggccgcgctcttttgttggtgcgcaacgtg
ggccacctgatgaccaaccccgcaattttggaccgtgagggtcgcgagattttcgagggg
ctgatggacgcgatgatcacatcgttgatcgccatgcacgacctcaaaaagaccgatggg
ctacgcaactcaacccatggctcggtctatgtcgtgaaacccaagatgcatggccccgaa
gaggtcgcctttgccgatcagattttctctcatgtcgaacgcgtgcttggcctgccccag
tatacggtcaaactcgggatcatggacgaggaacgccgcaccagtgtgaacctcaaggag
tgcatccgcgccgccaaatcccgcgttgcctttatcaacactggctttctcgaccgcaca
ggcgacgaaattcacacgtcaatggaagcaggcccgtttagccgcaaggatttcatcaag
cgcaagggatggatcaccgcctacgaagaccaaaacgttgatatcggtctggaatgcggc
ctgtcggggaaggcccagattggcaaagggatgtgggccgttcctgacaagatggcggat
atgctaagtgccaaaattgcacacccgaaatcaggggcaaattgtgcgtgggtgccaagc
ccgactgcggccacgttgcacgcacttcactaccaccaagtggacgtattcgccgtgcaa
gacaagttggccaagggcggtcgtcgcgctcatgtagatgctgttttggatattcctatc
gcacaataccgccgctggaccaaagaccagatcacccgcgagattgaaaacaacgcacag
ggcatccttggatatgtggtgcggtggatcaatcagggcgtgggctgttccaaagtgcca
gacatcaacgatgtcggcctgatggaagatcgcgcaacctgccgtatttcggcgcaacac
atcgccaactggctacaccacaacgtggcctcacacgcgcaagtgatggacattatgaaa
aagatggccgcagttgtagatcgtcaaaacgaaaacgacccaagctacactccgatgacg
cccgccctcgatgggatcgcgtttcaagcggcatgtgatctggtgttcaaagggcgcgaa
cagccctctggctataccgagccggtgctccatgtgcgccgcctcgaactcaaagcacag
taa

DBGET integrated database retrieval system