KEGG   Celeribacter marinus: IMCC12053_2783Help
Entry
IMCC12053_2783    CDS       T04098                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase, acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cmar  Celeribacter marinus
Pathway
cmar00071  Fatty acid degradation
cmar00072  Synthesis and degradation of ketone bodies
cmar00280  Valine, leucine and isoleucine degradation
cmar00310  Lysine degradation
cmar00362  Benzoate degradation
cmar00380  Tryptophan metabolism
cmar00620  Pyruvate metabolism
cmar00630  Glyoxylate and dicarboxylate metabolism
cmar00640  Propanoate metabolism
cmar00650  Butanoate metabolism
cmar00900  Terpenoid backbone biosynthesis
cmar01100  Metabolic pathways
cmar01110  Biosynthesis of secondary metabolites
cmar01120  Microbial metabolism in diverse environments
cmar01130  Biosynthesis of antibiotics
cmar01200  Carbon metabolism
cmar01212  Fatty acid metabolism
cmar02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cmar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    IMCC12053_2783
   00630 Glyoxylate and dicarboxylate metabolism
    IMCC12053_2783
   00640 Propanoate metabolism
    IMCC12053_2783
   00650 Butanoate metabolism
    IMCC12053_2783
  09103 Lipid metabolism
   00071 Fatty acid degradation
    IMCC12053_2783
   00072 Synthesis and degradation of ketone bodies
    IMCC12053_2783
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IMCC12053_2783
   00310 Lysine degradation
    IMCC12053_2783
   00380 Tryptophan metabolism
    IMCC12053_2783
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    IMCC12053_2783
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    IMCC12053_2783
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    IMCC12053_2783
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmar04147]
    IMCC12053_2783
Enzymes [BR:cmar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     IMCC12053_2783
Exosome [BR:cmar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IMCC12053_2783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ALI56730
UniProt: A0A0N9ZS98
Position
2718774..2719985
Genome map
AA seq 403 aa AA seqDB search
MTDAYIYDAIRSPRGKGRKDGALHEVTSVRLSSLMLNALADRNGLSGHAVEDVIWGNVTP
IGEQGACLARTAVLASNLDQSIPGLAINRFCASGMEAVNLAANQVQGGAGMGYIAGGVEM
MGRIPMGSDGAAIAADPSLAMSTYFVPQGISADIIATEYGFTREQADALAVESQNRAAAA
WADNRFDKSIVPVLDQNGLTILDRDEYMRPGTTTDALGALKASFKDMGEVMPGFDAVALM
KYPHLERINHIHHAGNSSGIVDGAAGVLIGNKEFGEKWGIKPRARIRATAKIGTDPTIML
TGPVPVTQKILADSGMSISDIDLFEVNEAFAAVVMRFMQAFNVDQAKVNVNGGSIAMGHP
LGATGAIIIGTLLDELERTGQGVGLATLCIASGMGAATIIERV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcctatatttatgacgcgatacgatcgccgcgcggcaaaggccgcaaagac
ggggccctgcacgaagtgacatccgtgcgattgtcgtcgttgatgctcaacgcgcttgcc
gaccgcaacggtctttcgggtcacgcggtcgaggacgtgatctggggcaatgtgacgccg
attggcgaacagggcgcgtgtcttgcacgcacggctgttctggcctccaaccttgatcaa
tccatccccggcttggcgatcaaccgcttttgcgcctcgggcatggaggccgtgaacctt
gcggcgaaccaagtgcaaggtggcgcaggcatgggctatatcgcgggcggcgtcgaaatg
atgggccgcattccgatggggtcggacggtgccgccattgccgccgatccatcgcttgcc
atgtcgacctattttgtcccacaaggcatctccgccgatatcatcgcgaccgaatacggc
ttcacccgcgaacaggcggatgctctcgccgttgaaagccagaatcgcgcagcagccgca
tgggcagacaacaggttcgacaaatccatcgtgcctgtgctcgatcaaaacggtctgacc
attttggaccgtgacgaatacatgcgtccgggcaccacaacggacgcgcttggtgcactc
aaagcctcgttcaaagacatgggcgaagtcatgcccggctttgatgctgtggcgttgatg
aagtatccgcaccttgaacgcattaaccacatccaccacgcgggcaactcgtcgggtatc
gtcgacggtgccgcaggcgtgctgatcggcaacaaggaattcggcgaaaaatggggcatc
aaaccccgcgcccgcatccgcgccaccgccaaaatcggcaccgacccgaccatcatgctc
accggccccgtgcccgtcacgcagaaaattttggccgacagtggcatgagtatttccgac
attgatctgtttgaggtcaacgaggcttttgccgccgtggttatgcggtttatgcaagcg
ttcaacgtcgatcaggcaaaggtcaacgtcaacggcgggtccatcgcaatgggccacccg
cttggcgcgacaggcgcaatcatcatcggcacgttgctcgacgaattggagcgcacgggt
cagggcgttggccttgccaccttgtgcattgcatccggcatgggtgccgcaaccatcatc
gaacgcgtgtaa

DBGET integrated database retrieval system