KEGG   Celeribacter marinus: IMCC12053_800Help
Entry
IMCC12053_800     CDS       T04098                                 

Definition
(GenBank) Aspartyl-tRNA(Asn) amidotransferase subunit B, glutamyl-tRNA(Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
cmar  Celeribacter marinus
Pathway
cmar00970  Aminoacyl-tRNA biosynthesis
cmar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmar00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    IMCC12053_800
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cmar03029]
    IMCC12053_800
Enzymes [BR:cmar01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     IMCC12053_800
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     IMCC12053_800
Mitochondrial biogenesis [BR:cmar03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    IMCC12053_800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ALI54748
UniProt: A0A0N9ZEH6
Position
803564..805081
Genome map
AA seq 505 aa AA seqDB search
MLDHLQFTTPKVKTIAGATDDWELVIGMEIHAQVASKSKLFSGASTKFGNEPNSNVSFVD
AAMPGMLPVINEFCVEQAVRTGLGLKADINLFSAFDRKNYFYPDLPQGYQISQLYHPIVG
EGEVIVDMEPGVARLVRIERIHLEQDAGKSIHDMDPNMSFVDLNRTGVALMEIVSRPDIR
GPEEAAAYVLKMRQILRYLGTCDGNMQNGNLRADVNVSVCRPGQYEKYQATQDFGHLGTR
CEIKNMNSTRFIQMAIDYEARRQIAILEDGGEVDQETRLYDAAKNETRSMRSKEEAHDYR
YFPCPDLLPLEIEQAWVDDIAKTLPELPDEKKARFVKDFALSEYDAGVLTAETENADYFE
NVVETGKDGKLSANWVINELFGRLKKDDKGIDTCPVTPAQLGGIVALITAGDISGKIAKD
LFEIVYTEGGDPAALVEKRGMKQVTDMGAIEAAVDEVIAANPDQVEKAKANPKLAGWFVG
QVMKASGGKANPAAVNKLIAEKLGL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaccatctccaattcaccacacctaaagtcaaaaccatcgcaggcgcgaccgac
gattgggaacttgtgatcgggatggaaatccacgcgcaggtcgcctccaaatccaagctg
ttttccggcgcgtcgacaaagtttggcaacgagccaaattccaacgtatccttcgttgac
gccgccatgcccggcatgttgcccgtcatcaacgagttttgcgttgagcaagcggtgcgc
acgggactgggcctgaaggcagacataaacctgttctcggcgtttgaccgcaagaactat
ttctaccctgatttgccgcaaggctaccagatcagtcagctctatcaccctatcgtgggc
gaaggcgaagtgatcgtggacatggaacccggtgtggcgcgtctggtgcgcatcgaacgt
atccacctcgaacaggatgcaggcaaatcgatccacgacatggaccccaacatgtcgttc
gtagatttgaaccgcacgggtgtggccctgatggaaatcgtgtcgcgtcctgacattcgc
ggccccgaagaggccgcagcttatgttctcaaaatgcgtcaaattctgcgctacttgggc
acctgtgatggcaacatgcaaaacggcaacctgcgcgcggacgtgaacgtgtcggtctgt
cgtccgggccagtacgagaaatatcaggcgacacaggactttggtcacctcggcacgcgt
tgcgagatcaagaacatgaactccacgcgctttatccagatggcgatcgactatgaggcc
cgccgccagattgccattcttgaggacggtggcgaagtggaccaagagacccgtctgtat
gatgcggcaaagaacgaaacacgctcaatgcgctccaaagaagaggcgcatgactaccgc
tattttccctgtcccgatcttttgccacttgagatcgaacaggcgtgggtggacgacatc
gctaaaacgcttcccgagcttcccgacgagaaaaaggcacgttttgtcaaagacttcgcc
ctgtccgaatatgacgcaggtgtgttgaccgccgagacggaaaatgccgattacttcgag
aacgttgttgagaccggcaaagacggcaagctgtcggccaactgggtgatcaacgagttg
ttcggccgcctgaaaaaggacgacaaaggcatcgacacctgccccgtgacccccgcacag
cttggcggcattgtcgcgctgatcacggcgggcgatatttcgggcaagatcgccaaagac
ctgttcgagatcgtctataccgaagggggcgatcccgccgccctcgttgaaaagcgcggc
atgaaacaggtcaccgacatgggcgccattgaggccgccgtggacgaggtcatcgcagcc
aaccccgatcaggtcgaaaaggccaaagctaaccccaaacttgcgggttggttcgtgggt
caggtgatgaaagcctcggggggcaaggcaaaccccgccgccgtgaacaaactgattgcc
gagaaactcgggctgtaa

DBGET integrated database retrieval system