KEGG   Cucurbita maxima (winter squash): 111468422Help
Entry
111468422         CDS       T05246                                 

Definition
(RefSeq) guanine nucleotide exchange factor SPIKE 1 isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
cmax  Cucurbita maxima (winter squash)
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cmax04131]
    111468422
Membrane trafficking [BR:cmax04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    111468422
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 TerB
Motif
Other DBs
NCBI-GeneID: 111468422
NCBI-ProteinID: XP_022969402
Position
Unknown
AA seq 1831 aa AA seqDB search
MHLLHRRDSTPASIKWHNKFEENLEQWPHLNELVQCYSTDWVKDENKYGHYETIGPVSFQ
NQIYEGPDTDIETEMRLTYARRMKPDDTTEDDVPSTSGRPETTTHDPLSSNIPKQFDHSP
LPAYEPAFDWENERSMIFGQRIPETPVTHGLKISVKVLSLSLQAGLCEPFYGTICLYNRE
RREKLSEDFHFRITPKEMQDPKISFEPHGIFYLEAPSASVCLFIQLEKHATEEGGVAASV
YSRKEPVHLSEREKQKLQVWSQIMPYRESFAWAIVALFDNSTGAASAGSASPSSPLAPNI
TGSSSHEGVFEPSTKVTVDGKLGCSSGSSVVVEISNLNKVKEGYTEDALQDPKYKVHKPV
KGVLRLEIEKHQISHADNENMSENGSVISDSVEMDSTFKKLPNNGSDSHHHSGSLKLNFS
DGKEFSGNGSYPHGNADSSADDFHAFDFRIMMRNEPFLQLFHCLYVYPMTVSLNRKRNLF
IRIELREDDSDPRRQPLEAMYPVELGASLQKWTHTQVAVAARVACYHDEIKLSLPATWTP
KHHLLFTFFNIDMQAKLEAPMPVPIGYASLPLSAHAQLRSEISLPVMRELVPHYLQDTNR
ERLDYLEDGKNIFKLRLRLCSSLYPINERIRDFFLEYDRHTLRTSPPWGSELLEAINSLK
NVDSTALLQFLHPILNMLLHLIGNGGETLQVAAFRAMVNIVTRVQQESAEDGERNHFLVN
YVDYAFDDFGGRQPPVYPGLSTVWGSLARSKAKGYRVGPVYDDVLAMAWFFLELIVKSMA
LEKTRLFYHSLPLGEDIPPMQLKEGVFRCIMQLYDCLLTEVHERCKKGLSLAKRLNSSLA
FFCYDLLSIIEPRQVFDLVSLYLDKFSGVCQSVLHDCKLTFLQIICDHDLFVEMPGRDPS
DRNYLSSVLIQELFLTWDHDDLPLRAKAARILVVLLCKHEFDARYQKPEDKLYIAQLYFP
LIGQILDEMPVFYNLNAIEKREVLIVILQIVRNLDDTSLVKAWQQSIARTRLFFKLMEEC
LILFEHRKPADGMLMGSSSRSPAAVGDTPGSPKYSDRLSPAINNYLSEASRQEFRPQGTP
DNGYLWQRVNSQLSSPNQPYSLREALAQAQSSRIGASAQALRESLHPVLRQKLELWEENL
SAAVSLQVLEITEKFSLMASSHSIATDYGKLDCITSIFMSFFSKNQPLAFYKALFPVFNS
VFDLHGATLMARENDRFLKQVTFHLLRLAVFRNDSIRKRAVSGLQILVRSSFCHFMQTAR
LRVMLIITLSELTSDVQVTQMKANGTLEESGEAQRLRKSLEDMADESKSSDLLKECGLPE
NALVIIPEASADNRWSWSELKYLSDSLLLALDASLEHALLASMMSMDRYAAAEGFYKLAM
AFAPVPDLHIMWLLHLCDAHQEMQSWAEAAQCAVAVAAMVMQALVARNDGVWSRDHVAAL
RRICPMVSGEITSEASAAEVEGYGASKLTVDSAVKYLQLANKLFSQAELYHFCASILELV
IPVYKSRRAYGQLAKSHTLLTNIYESILEQESSPIPFTDATYYRVGFYGESFGKLDRKEY
VYREPRDVRLGDIMEKLSHVYESRMDGSHTLHIIPDSRQVKAEELQPGACYLQITAVDPV
IEDEDLGSRRERIISLSTGSVRARVFDRFLFDTPFTKNGKTQGGLEDQWKRRTVLQTEGS
FPALVNRLLVTKSESLEFSPVENAIGMIETRTAALRNELEEPRSSEGDQLPRLQSLQRIL
QGSVAVQVNSGVLSVCTAFLSGEPATRLRSQELQQLIAALLEFMAVCKRAIRVHFRLIGE
EDQEFHTQLVNGFQSLTAELSHYIPAILSEL
NT seq 5496 nt NT seq  +upstreamnt  +downstreamnt
atgcatctcctacatcgccgagattccactcccgcgtctatcaaatggcacaacaagttt
gaggagaatttggagcaatggccacatctcaatgagctcgtgcagtgctattccactgac
tgggtaaaggatgaaaacaagtacggtcactatgagactattggtcccgtgtcctttcag
aatcagatatatgaaggccccgacactgacattgagactgaaatgcgtcttacttacgct
aggcgcatgaagcctgacgatactacagaggatgatgtacctagtacctctggacgacca
gagactacaacacatgatccattgtcatcaaatattccaaagcagtttgatcattctcct
cttccagcttatgagccagcttttgattgggaaaatgaaaggtcaatgatatttggccag
aggataccagaaactcctgtaacacatggcttgaagatttctgtgaaagttctatcctta
tcccttcaagcggggttgtgtgagccattttatggtacaatttgcttgtataatagggag
agaagagaaaaactatctgaggatttccattttcgcattactcctaaagaaatgcaggat
cctaaaatatcattcgaaccacatggaattttctatttggaggctccatcagcatcagtc
tgtctttttattcagttagagaagcatgccacagaagaaggaggggttgccgcttctgtg
tattcacgtaaagaaccagtgcatttgagtgaaagagaaaagcaaaaactgcaagtgtgg
tctcaaatcatgccttacagagaatcctttgcctgggccattgttgcattatttgataac
agcactggtgcagcatctgctggatctgcttccccgagtagtcctcttgctcccaacata
actggatctagttcccatgagggtgtatttgaacctagcacaaaggtcacagtggatggt
aagctgggttgctctagtggaagctctgtggttgttgaaatatccaacttaaataaggtc
aaggaaggctacacggaagatgcacttcaggatcccaagtacaaggttcataaacctgta
aaaggtgttcttaggctggaaattgaaaagcaccagatttcccatgctgacaatgaaaac
atgtcagaaaatggtagtgtgatcagtgactctgttgagatggattccacattcaagaag
cttcctaataacggttctgatagccatcatcatagtggcagcttgaagttaaatttttct
gatgggaaagaattttctggtaatggatcatatccacatggaaatgcagattcaagtgca
gatgatttccacgcatttgacttccgcattatgatgaggaatgagccgttcttgcagctc
tttcactgtctttatgtttaccccatgactgttagtttgaaccgcaagaggaacttgttc
attcgtatagaacttagagaggatgatagtgacccgcgtagacagcctctggaggctatg
tatcctgtggagctgggtgcttctcttcagaagtggactcacactcaagttgctgtagct
gcaagagtagcttgctaccatgatgagattaaactctccctccctgctacctggacacca
aagcatcacttattattcacattcttcaacattgatatgcaagcaaaactagaagctcca
atgccagtgccaattggatatgcatcacttcccttatcagcacatgctcagttacggtct
gaaatttctttaccagtaatgagagagcttgttccgcattacctccaagatacaaacagg
gagaggctagattacttggaagatggaaaaaacatctttaaattgcgtttaagactgtgt
tcctccctgtatcccattaatgaacgaatcagggatttttttctggaatatgatagacac
actcttcgaacaagccctccatggggttctgaacttctggaggctattaacagtttgaag
aatgttgattccactgcgttgctccaattccttcatcctattttgaatatgttgcttcat
ctgattggcaatggtggagaaaccctccaggttgcggcgtttagagcaatggttaatatt
gttactagggtgcagcaggaatcggctgaagatggtgaaagaaaccacttcctggttaat
tatgtcgattatgcttttgatgacttcggaggtcgacagccacctgtgtaccctggtctg
tccactgtctggggaagcttggctaggagcaaggccaaaggctatcgtgttggaccagta
tatgatgatgttttggctatggcctggtttttccttgaactaattgtcaaatcaatggca
ctggagaaaactcggcttttctatcatagtcttccattaggtgaagatattcctccaatg
caattgaaagaaggtgtatttagatgcataatgcagttgtatgattgccttcttactgaa
gtacacgaacgttgcaagaagggattaagcttggctaaacgtttgaatagcagtttagcg
ttcttttgttatgatcttttgtccattattgaacctcgccaagtatttgatttggtatcc
ttgtacctggacaagttttcaggtgtctgccaatctgttctgcatgactgcaagcttaca
tttttacagattatatgtgatcatgacctctttgtggaaatgcccggaagagacccttct
gataggaactacctttcatctgtattaatacaagaactttttcttacttgggatcatgat
gatttacctctgcgggccaaggcggctagaattttagttgttctcttatgcaagcatgaa
tttgatgctcggtaccagaagcctgaagataaactatacattgctcagctgtattttcca
cttatcgggcagattttagatgaaatgcctgtcttctataacctaaatgccatagagaag
cgtgaagttttgattgtgattttgcaaattgtgcgcaatttagatgatacctcacttgtc
aaggcatggcaacaaagcattgctcgaaccagattatttttcaagctcatggaagaatgc
ctaattctttttgagcatagaaaacctgctgatggcatgcttatgggatccagttctcgg
agccctgctgctgttggtgatacccctggttcccccaagtactctgacagactatctcct
gcaatcaacaactacctatctgaggcatcaagacaagaattcagacctcagggaacacct
gataatggttatctgtggcagagggtgaattctcagttgagctccccaaatcagccatat
tcgttgagagaagcacttgcccaggcacaatcttctaggattggtgcatcggctcaggca
ctaagagagtcgctgcacccagtattaagacaaaaattagaactttgggaagaaaactta
agtgcagcagttagccttcaggttttggaaataaccgagaagttttccttgatggcatct
tctcatagcattgccactgactacgggaaacttgattgcatcacctccatattcatgagc
ttcttctctaagaatcaacctttggcattctacaaggccttatttcccgtctttaacagt
gtctttgatcttcatggtgcaactttaatggcgagagaaaatgaccgtttcttgaagcaa
gtaacattccatcttcttaggcttgcagtttttcgaaatgatagcataaggaaaagggct
gtttcagggcttcagattcttgtgaggagttctttctgtcactttatgcagacggctaga
ttgagggtcatgctcataattactttatcagaattgacgtctgatgtgcaagtaactcag
atgaaggcaaatgggacacttgaagagagtggtgaagcacagcgtcttcgaaaatcctta
gaagacatggctgatgaatcgaagagttctgatctgctgaaggaatgcggacttcctgag
aatgctcttgtaataattccagaagcttctgctgacaataggtggtcctggtcagagttg
aaatatctttctgacagcctccttcttgctcttgatgctagtctagagcatgctctttta
gcctctatgatgtcaatggatagatatgctgctgcagaaggtttctataaacttgcaatg
gcattcgcccctgtgcctgatcttcatattatgtggttattgcatttatgcgatgcacat
caagagatgcaatcgtgggcagaagctgcacagtgtgctgtagcggttgcagctatggtc
atgcaggctcttgttgctcgaaatgatggtgtctggagcagagatcatgtagcagctcta
cgtagaatttgccctatggtcagcggtgagatcacctcggaggcatcagcagctgaggtc
gagggatatggtgcttctaaactcactgtcgactctgctgtgaagtacctacagctcgca
aacaagcttttctcccaagctgagttgtatcatttttgtgctagtattctggaacttgta
attccagtctataaaagtaggagagcatatggacaactggcaaaaagtcacactttactg
acaaatatttacgaatcaatccttgagcaggagtcgagcccaattccatttactgatgca
acatattatagggtgggattctatggtgaaagtttcgggaagctggataggaaggaatac
gtttatcgtgagccccgtgatgtgcggttaggtgacataatggagaagctcagtcatgta
tatgaatctaggatggatggcagtcacacactgcatattattccagactccagacaagtg
aaagcggaggagttgcagccgggagcttgctacctacagataacggcagttgaccctgtc
attgaagatgaagatctgggaagtagaagagagagaatcatttctctatccactgggagt
gtccgtgctcgtgtatttgaccgtttcttatttgatacaccatttaccaaaaatggaaag
actcaaggtggactagaagaccagtggaagaggaggactgttctacagaccgagggctcc
ttcccggcattggtaaatagactcttagtaaccaaatccgaatcgctcgagttctcccct
gtggaaaatgcaattggaatgattgaaactagaaccgctgctctgcggaatgaactggaa
gagcctcgcagttctgagggggatcaacttccacgactccagagtctccagagaatactc
caaggcagtgttgcagttcaagttaacagtggagtgttgagtgtgtgcactgcattcttg
tccggtgagccagctacgaggttgcggtcgcaggagttacagcaactcattgctgcgctt
cttgaatttatggctgtatgtaagcgtgcaattcgagttcatttcagattaattggagag
gaagaccaggagttccacacccaactggtgaatggatttcagtccctcaccgccgaacta
tcgcattatattcccgccattctatctgaattgtaa

DBGET integrated database retrieval system