KEGG   Cucurbita maxima (winter squash): 111468937Help
Entry
111468937         CDS       T05246                                 

Definition
(RefSeq) acid beta-fructofuranosidase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
cmax  Cucurbita maxima (winter squash)
Pathway
cmax00052  Galactose metabolism
cmax00500  Starch and sucrose metabolism
cmax01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    111468937
   00500 Starch and sucrose metabolism
    111468937
Enzymes [BR:cmax01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     111468937
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 111468937
NCBI-ProteinID: XP_022969869
Position
Unknown
AA seq 687 aa AA seqDB search
MVKLNPFSTFPATADPPQNLPFYNPLPHEPVEPVESPPIRRRPFKGGLYIFTGLLLVGLS
VALICQNGLGPVAKLQGNSLLISKSPKILRPSSRGVSAGVSEKANPQFLGRRVASFPWNN
SMLSWQRTAFHFQPEQNWMNDPNGPLYHMGWYHFFYQYNPQAAVWGNIVWGHAVSRDLIH
WLHLPLALLPDHWYDINGVWTGSATVLPDGQIMMLYTGSTKESIQVQNLAYPANLSDPLL
IDWVKFPGNPVLVPPPGIDFKDFRDPTTAWLTSEGKWRLAVGSKVNRTGISLLYETEDFQ
RFHLLDNLLCAVSDTGMWECVDFFPVSKTENYGLDTSANGPEVKHVMKTSLDDDRHDYYS
LGTYDEKTGTWIPDDPKIDVGIGLRYDYGIFYASKSFYDHNKGRRVLWGWIGESDSEFAD
VQKGWASVQSIPRTILFDNKTGTNLLQWPVEEVESLRQESHVFNNLVVKAGSVLPLDVGI
ATQLDISAEFKLDKEALEKATKTNVEFSCQTSGGATERGALGPFGLSILADESRSEHTPV
YFYVAKDQNGSLKTFFCTDESRSSEASDVFKPIYGSAVPVLEDEKFTLRILVDHSVVESF
AQGGRTCITSRVYPTKAIYGAARLFVFNNAKDIDVIASITVWQMNPALIRPYRPGGDDDS
SKSSVVLIPVYLFLLVSFLHLIVYKGA
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagttgaatccattttctactttccctgccaccgctgatccaccgcagaatctc
cctttctacaatcctcttcctcatgaacctgtcgaacccgttgaatctccgcctattcgc
cgccgaccctttaagggaggcctctacatttttactgggttgctcttggttggcttatcg
gtcgctcttatttgtcagaatggcttgggacctgtcgccaaattgcaaggaaattcgctc
ttaatctccaagtcgccgaagatattgcgtccgtcgtcacgtggggtgtcggccggcgtg
tcggaaaaggcaaatccgcaatttcttggccggagagtcgcttcgtttccttggaataat
agtatgttgtcgtggcagagaacggcattccatttccaaccagagcagaattggatgaat
gatcccaatgggccattgtatcacatggggtggtaccatttcttctaccaatacaaccca
caagctgcagtgtggggaaacattgtgtgggggcatgcagtctcaagggatttgattcat
tggcttcaccttccattagccctgcttccagatcattggtatgatatcaatggcgtttgg
actggttccgccactgttcttcccgatggtcaaatcatgatgctctacactggctccaca
aaagagtctatccaagttcaaaacctggcatatccagccaatttatctgatcctttgctc
attgattgggtcaagttccctggcaatccagttcttgttcccccacctggtattgatttc
aaggacttccgtgatccaacgactgcgtggctcacgtcggaagggaaatggcgattggcg
gtcggatcgaaggtcaatcgaactgggatctcgttgttgtatgaaacagaagacttccaa
cgctttcatctgttggacaatctgctttgtgctgtttctgatactggaatgtgggaatgt
gtggacttctttcctgtatctaaaactgagaactatggcttggatacgtcggctaatgga
cccgaggtgaagcatgttatgaagacgagccttgacgatgatcgacacgattactattcg
ctcggaacatatgatgagaagactggtacttggattcctgatgatcccaagattgacgtt
gggattggcttgagatatgactatgggatattctatgcgtccaagtctttctatgaccat
aacaaaggaagaagagtgttgtggggttggattggagagtcggatagtgaatttgctgat
gttcagaagggatgggcatcagttcaaagcattccaagaactatcttgtttgataataaa
actgggaccaatctactccaatggccagtcgaggaagtagaaagcttgagacaagaaagc
catgtgttcaacaatttggtggtcaaggcaggatcagtgctaccacttgacgttggcata
gccactcagttagacatatcagccgagttcaagttggataaggaagcattggagaaagca
accaaaacaaatgtagaattcagctgccaaacaagtggtggagcaacggagcgtggcgca
ttgggaccattcggtctttcgatacttgcagacgagagccggagcgagcatactccagtc
tacttctatgttgcaaaagaccaaaatggtagtctcaagacattcttctgcactgatgaa
tcaagatcctctgaggcaagcgatgtgttcaagccaatatatggaagtgctgttccagtg
ctagaagatgaaaagttcactttaagaatacttgttgatcattcagtggtggaaagtttt
gctcaaggtggaagaacttgcatcacatcaagagtttatccaacgaaagcgatctacggt
gctgctcggttattcgtattcaacaatgcaaaggatatcgacgtgatagcctcgatcact
gtatggcagatgaatcctgcattgatacgcccatatcgccccggtggagatgatgactcg
tctaaaagttcagtcgttttaataccggtctacctgttcctattggtttcatttttgcat
ctgatcgtatacaagggtgcatga

DBGET integrated database retrieval system