KEGG   Cucurbita maxima (winter squash): 111468977Help
Entry
111468977         CDS       T05246                                 

Definition
(RefSeq) ATP-dependent RNA helicase DEAH12, chloroplastic-like
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
cmax  Cucurbita maxima (winter squash)
Pathway
cmax03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    111468977
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cmax03041]
    111468977
Enzymes [BR:cmax01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     111468977
Spliceosome [BR:cmax03041]
 Complex C
  Other components
   Step II factors
    111468977
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C OB_NTP_bind IBR HA2 DEAD AAA_22 zf-RING_2 AAA_19 Helicase_RecD zf_CopZ zf-RING_UBOX ABC_tran AAA_30 AAA_29 T2SSE DUF2075
Motif
Other DBs
NCBI-GeneID: 111468977
NCBI-ProteinID: XP_022969963
Position
Unknown
AA seq 1745 aa AA seqDB search
MKSSSSSSSSSSTTVFRPPDSSLTCNRPSYLQYLPRSPNGASRPGFPVKFHNCSGQRTSP
NRANFVIDLVLDHRGVAKCSVEVLMAKCNSKPDNFIVPQGGPVVAFLFFKQWVSALEAMV
TFWELRLDGLHDFTPILKPRINLPSDADELHDRLRNLFAERIQRLMDGEKVRDWQKKRDL
VKVQIDRISHSLRKPLGIATQFELKEKRKGLIVEKDSIMRNTEEFKSAMRYILDYVEGKK
LELSDSEDVGVFKFDETISWNRIHSLILRECRRLEDSLPMYSCRREILRQIHSQQVMVLI
GETGSGKSTQLVQFLADSGLSSSESIVCTQPRKISATSLAHRVREESRGCYDDDCISCYP
SFSSAQQFKSKIIYMTDHCLLQHYMNDKKLSDVSCIIIDEAHERSLNTDLLFALLKSLLM
VRVDLHLIIMSATANADQLSKYFFGCGIFHVPGRNFPVDIRYVPSLDEGSSGPCTVASYV
TDVVRMASEIHWKEKGGTILAFLTSQMEVEWACENFHAPGTVPLAFHGKQSFDEQFRVFQ
DHPGKRKVIFATNLAETSLTIPGVKYVIDPGWVKDSKFEPRNGMNILKVCRTSQSSANQR
AGRAGRTEPGRCYRLYSQSDFELMSPNHEPEIRKVHLGVAILRILALGVKNVDDFDFVDA
PSAEAVDMAIRNLVQLGAITLNSNVYELTNEGRNLVKLGIEPRLGKLILSCFNCRVRREG
VVLAVLMTNASSIFCRVGKVEDKLKSDCQKVQFCHPDGDLFTLLSVYKQYEALPRERKNQ
WCWENSINAKTMRRCQDAILELERCLKQELNIIIPSYWLWSSLKPTDHDRNLKKCILASL
SENVAMFTGYDRLGYEVAMTGRHVQLHPSCSLLIFSEKPKWVVFGEILSISNEYLVCVTA
IDVDALSTISPPPLFDISLMEKHRLEVRTLSGFGKTLLKRVCGKSNSNLISLTSHVRKVF
SDDCIGIEVNINQNEILLFSRSENMDAVYHFVNDILEYERKYLWNECMEKCLYHGNDGSP
PVALLGSGAKIRHLELEKRYLTVDVFRSNVDSIDDKELFMSLEKSVSGTICTIQKVPCSG
QDDDDKERGHRITFLTPDAAEKALKLDGGFFCGSLVKIIPMRITAGCDNKLFSFPPVKAK
VFWPRRLSKGFAVVKCNSYDVSFLVNDFSNLLNGERFLRCEPSIKYNDCVTLSGIDKELS
EADIFNVLRSATDRKILDLFLVRENPVSNPPVNACEEALLKEISAFMPKSHPHVKCCYVQ
VFQPQPKDFYMRAAITFDGRLHLEAAKALEYLEGKALPVCFPWQKIKCQQLFHSTLSCTI
PIFRVIKCQLNSLLESLKKIDGAECTLSQNINGSYRVKLSANATKTVAELRRPVEALLRG
KIIDHASLTPTVLQHLNSRDGFDLINLLQRENEVYILVDRQRLSLRIFGASENVAAAERK
LIQSLQTLHERKQLEIHLRGKSRPPNLLKTVVEKFGPDLNGLKQKFPEAGFTLNTRHHIL
SVHGSKDLKHDVETIIYELEKTSGGLAERPDDADACSICLCDIEDDRFELEACGHHFCRQ
CLVEQFESAIKNHGSFPVCCAKQTCQSPILLTDMRYLLSNEKLEELFRASLGAFVAGDSA
YRFCPSPDCPSVYRVASPDTCGEPFMCGACFSETCTRCHLEYHPFLSCEQYRVFKEDPDS
SLDEWRKGRENVKNCPVCGYTIEKIEGCNHIECKCGRHICWVCLDYFGSSDECYGHLRSI
HMAFV
NT seq 5238 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcctcctcctcctcctcctcctcctcctccaccaccgtcttcaggccgccggat
tcttccctcacatgtaatcgaccttcctatttacagtacctgccgcgttctccgaacgga
gcttccaggccaggttttcctgtgaaatttcataattgttctggacaacgaacttcccct
aaccgcgcaaattttgttattgatctcgtcttggatcatcgcggcgttgccaagtgctct
gttgaggttttaatggccaaatgcaattccaagccggacaattttattgtccctcagggt
ggtcctgttgttgcgtttttgtttttcaagcaatgggttagtgcgcttgaggctatggtg
acgttttgggaattgcgcctcgatgggcttcatgatttcactccgattcttaaacctagg
atcaatttgccctctgatgctgacgaactccatgaccgacttcggaacctctttgctgaa
agaatacagcgtcttatggatggcgaaaaggtccgagattggcaaaagaaacgcgatctt
gttaaggttcagattgatcgaatttctcatagcctacggaagccccttggtattgccact
cagtttgaactcaaagaaaagaggaaggggcttattgtcgagaaggattcaattatgagg
aacacggaagagtttaagtctgctatgcgttatattctggattatgtggaaggaaagaaa
ctggaactatcagatagcgaagacgtgggagtttttaaatttgacgaaacaattagctgg
aaccgaattcatagcttgattttgagagaatgccgcaggcttgaggatagtttgcccatg
tattcttgccgccgggaaatccttcggcaaattcacagtcaacaggtaatggtattgatt
ggagaaactggttcaggaaagagcacacagttggttcaatttcttgctgattcgggactt
tcttcttctgagtcaattgtatgtacacagcctcgcaagatatctgctacctcccttgcc
catagggtgagagaagaaagccgtgggtgttatgatgatgattgtataagttgttatcca
tcattttcatctgctcaacagttcaaatctaagataatatacatgacagaccactgttta
ctgcagcactacatgaatgataagaaactttctgatgtttcctgcattataattgacgag
gctcatgaaagaagcctgaatactgatctcctttttgcattactgaaaagtttactcatg
gtgagagttgatttgcatcttattattatgtctgcaacagccaatgcagatcagctatca
aagtacttctttggttgtggaatctttcatgtaccggggaggaactttcctgttgatatt
agatatgttccttctttggatgaaggctcttctggtccttgcactgttgcttcatatgtt
acggatgttgtaagaatggcatcagagattcactggaaagaaaagggagggactattctt
gcctttttgacttctcagatggaagtggaatgggcatgcgaaaattttcatgctcccggt
acagttcccttggcatttcatgggaagcaatcctttgatgagcaatttcgagttttccag
gaccaccctggtaaaagaaaggtaatttttgccacaaatcttgcagagacatcattgaca
attcctggggtgaagtatgttatagatcctggttgggtgaaagatagcaaatttgaacct
agaaatggtatgaatatccttaaggtatgcagaaccagtcagagttctgctaatcagcga
gctggtcgtgctggtagaacagaacctggaagatgttatagactgtactcccagtctgac
tttgagttaatgtctcctaaccatgaacctgagattcgaaaagttcatcttggtgttgca
atattgagaattcttgccttgggtgtaaagaatgtagatgattttgactttgtagatgct
cccagtgcggaagctgttgacatggccatcaggaatctcgttcagttgggagctattaca
ctgaatagtaatgtttatgaactaacaaatgaaggtcgtaatttagtaaagttgggcatt
gagccacgccttggcaagttgattcttagttgcttcaattgtcgtgtacgtagagagggt
gttgtacttgctgttttaatgacaaatgctagtagtatattttgccgagttggtaaggtt
gaagataaattaaaatctgattgccagaaggttcaattttgccaccctgatggtgacctt
ttcactctgctctcagtttataaacaatatgaagccttgcctagggagaggaaaaaccaa
tggtgttgggagaacagcattaatgccaaaactatgagaagatgccaagatgccatcttg
gaattggaacgttgtctcaaacaagaacttaacattatcatcccaagttactggctttgg
agttcgctgaagcctacagatcatgacagaaatcttaaaaagtgtatacttgcttctctt
tctgaaaatgtggccatgttcactggttatgatcgactgggttacgaagtggcgatgact
ggacgacatgttcaactacatccatcatgttctttgctaatatttagtgagaagcccaaa
tgggtggtgtttggtgaaattttgtcaataagtaatgaatatttggtatgcgtaactgcc
attgatgtagatgctttgtctaccatttcccctccccctttgtttgacatttctcttatg
gagaaacacaggctggaggtacgaactcttagtggctttggcaaaactctgcttaaaagg
gtttgtggaaaaagcaacagtaatcttatttctcttacatcacatgttcgtaaagttttc
agtgatgactgcataggcattgaagtaaatataaatcagaatgagattctgttgttctca
agatcagagaacatggatgcggtttatcattttgtaaatgatattttggagtatgaaagg
aaatatttatggaatgaatgcatggagaaatgcttgtatcatggaaatgacggctcacct
cctgttgctttgttgggttctggtgctaaaataagacatctggaacttgagaagagatat
ttgactgttgatgtatttcgttcgaatgtggattccattgatgataaggaactttttatg
tctcttgagaaatctgtatctggtactatttgtactattcaaaaagttccatgttctgga
caggatgatgatgataaagaaagaggacatagaataacatttcttactcctgatgcagct
gaaaaagctttgaagctcgatggtggtttcttttgtggatccttggtgaagataattcct
atgcggatcactgctggatgtgataataaacttttctcttttcctcctgtcaaagctaaa
gtcttctggcctcgtaggttgagcaaaggatttgcagttgttaaatgtaacagttatgat
gtcagtttccttgttaatgatttctctaacctactgaatggagaaaggttcttacgttgt
gaacctagcataaagtacaatgactgtgttaccttaagtggaatcgacaaagagctttct
gaagctgatatttttaatgttctgaggtctgcaacagacaggaaaattttggatcttttt
cttgttcgggaaaatcctgttagcaatcctccagtcaatgcttgtgaagaagctcttctg
aaagaaatctctgcttttatgccgaaatcccaccctcatgtcaaatgttgctacgttcaa
gtttttcaacctcaacccaaggatttttacatgagagctgcaataacttttgatggaaga
ttgcacttggaggcagcaaaagccttggagtatttggaaggaaaagcactgccagtatgt
tttccatggcagaaaattaagtgccagcagctatttcatagcactttatcctgcaccatc
cccatatttcgagtgatcaaatgtcaactgaattccttacttgaaagcttgaagaagata
gatggtgcggaatgcactctttctcagaacatcaatggttcctaccgagtgaagctttct
gccaatgccacgaaaacagtagccgagctgagacgaccagtggaagcacttctgagaggg
aagattatagatcatgctagcctgactcctacagttcttcagcatctgaactctagagat
ggctttgatctaataaatttactacagcgggaaaatgaggtctacattctcgttgacagg
cagagacttagtctacgaatttttggtgcttctgagaacgtagctgcagctgagcgaaag
ttgattcaatccctacagacacttcatgagcgcaagcaacttgagattcaccttcgaggc
aaatctcggcctcccaatctcctgaagacagtggttgagaagttcggccccgatctcaat
ggccttaaacagaagtttccagaagctggatttacattaaatacccggcatcatatttta
tctgtccatggtagtaaagatttgaagcatgacgttgaaacaattatttatgagcttgaa
aagacgagtggtggtttagccgagaggcctgatgatgcagatgcttgttcaatttgctta
tgtgacattgaagacgacaggtttgaacttgaagcctgtggacaccatttttgccggcaa
tgccttgtggaacagtttgaatctgccatcaaaaaccatggaagcttcccagtttgttgt
gccaaacaaacatgtcaatctcccatattacttacagatatgagatatctgttgtcgaac
gagaagctggaggaactgtttcgagcttcattgggagcttttgttgctggtgacagtgcc
tatagattttgcccatcgcccgactgcccctcagtttaccgagtggccagtcccgataca
tgtggggaaccattcatgtgtggagcatgcttttcagaaacttgtactagatgccatttg
gagtatcatccattcctatcgtgcgaacagtaccgagtgttcaaggaagacccagattcg
tcactggacgagtggcgcaaaggtagagagaacgtcaagaactgccccgtctgtgggtac
acaattgagaagattgaagggtgtaaccacattgaatgcaagtgtggaaggcatatttgt
tgggtctgtttggattattttggtagcagtgacgaatgttatggtcatttgaggagcatt
catatggccttcgtttaa

DBGET integrated database retrieval system