KEGG   Cucurbita maxima (winter squash): 111469643Help
Entry
111469643         CDS       T05246                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: external alternative NAD(P)H-ubiquinone oxidoreductase B2, mitochondrial-like
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
cmax  Cucurbita maxima (winter squash)
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    111469643
Enzymes [BR:cmax01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     111469643
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox NAD_binding_8 EF-hand_1 NAD_binding_7 Pyr_redox_3 EF-hand_7 EF-hand_8 p25-alpha EF-hand_6 DUF1858 EF-hand_5
Motif
Other DBs
NCBI-GeneID: 111469643
NCBI-ProteinID: XP_022970745
Position
Unknown
AA seq 584 aa AA seqDB search
MAWNSFYNRASKAYHNHPNISKLLVVFAASGGGLVASTNAKSLYPSAFADAVQQDGDWRK
KKKKKVVVLGTGWAGTSFLKNLKSSSYDVHVISPHNYFAFTPLLPSVTCGTVEARSIVEP
IRSITKKKGLSIEFREAECYKIDAENKKVFCRSTQDTNLGGKEEFSVDYDYLIVAMGAKS
NTFNTPGVEENAHFLKGVEDAQQIRQSVIDCFERASLPNLSEEEKKRTLHFVIVGGGPTG
VEFAAELHDFAAEDLAELYPSLKEYVKITLLEAGDHILNMFDKRITAFAEDKFQRDGINL
KTGSMVVKVTDKEISTKERATGEFVSVPYGMVVWSTGIGPRPQVVDFMKQIXRALVTDEW
LRVEGCDGVYAFGDCATINQRKVMEDIAVIFSKADTDNSGSLALQEFQEAVKDICERYPQ
VEIYLKKNKMKNFAALLKKSQLDTQRQSTELDIESFTSLLSEVDAQMKNLPATAQVAAQQ
GEYLATCFNKMEQCEKYPEGPLRYRGTGRHRFRPFRYKHFGQFAPLGGEQTAAQLPGDWI
SIGHSSQWLWYSVYTSKLVSWRTRVLVLSDWARRFIFGRDSSRI
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggcatggaattccttctacaacagagcctctaaggcttatcacaaccatcccaacatc
tccaagctcctcgtcgtcttcgcagccagtggaggtgggctggtggcaagtactaatgcc
aaatctctgtacccttctgcatttgctgatgccgtccaacaagatggtgattggaggaag
aagaagaagaagaaggtggtggtgcttggaacaggatgggccggcaccagcttcttgaag
aacctcaagagctcctcttatgatgttcatgtcatttcccctcataattacttcgctttc
acccctttgcttcctagtgtcacttgtggcaccgtcgaggcacgcagcattgtcgaacca
attcgtagcatcaccaagaagaaaggattgagcattgaatttagggaagctgagtgttat
aagatagatgcagagaacaagaaggtgttctgtcgatcaactcaagacacgaacttgggt
ggcaaggaagagttttcagtggactacgactatctgatagtagccatgggagctaaatcc
aacactttcaacacaccaggagtagaggaaaatgctcatttcttgaagggagtggaagat
gctcagcagattcgacagtcggtaatcgattgtttcgagcgagccagccttccaaatcta
agtgaagaagagaagaagagaacccttcactttgttatagttggaggaggtccaacagga
gtggaatttgcagcagaacttcatgactttgctgcagaggatttggcagagttgtatcct
tcattgaaagaatacgtgaaaatcaccctcctagaggcaggcgatcatattttgaacatg
tttgacaagaggattacagcctttgctgaagacaagtttcaaagagatgggattaactta
aaaactggttccatggttgtgaaagtaactgataaggaaatctccacaaaagaaagagca
accggtgagtttgtgtctgttccttatggaatggttgtctggtccaccggcatcggtcct
cggcctcaagtcgtcgacttcatgaagcagattngacgagctttggttactgatgaatgg
ctaagggttgaaggatgtgatggtgtctatgcttttggtgattgtgccacaataaaccaa
agaaaagtcatggaagatattgctgtgatattcagcaaggcagacacagacaattcagga
agtttagccctgcaagagtttcaagaagcagtaaaggatatttgtgagaggtaccctcaa
gtagagatctatctgaagaagaataagatgaagaactttgcagccttgttgaagaagtcc
caattggacacacagagacagtcgaccgagctcgatatcgaaagctttacgtccttactt
tccgaagtcgatgctcagatgaaaaatctgcctgctactgctcaagttgctgctcaacaa
ggtgagtatcttgctacctgcttcaacaagatggaacaatgtgagaagtacccagaaggc
cctctccgatatagagggacggggcgacatcggtttcgtcccttcaggtacaagcatttt
gggcagtttgctcctcttggtggagaacaaactgcagctcaactacctggagattggatt
tcaataggtcatagcagccagtggctttggtactctgtgtatacaagcaagctagtaagc
tggcgcacgagggttctggtcctatcagactgggctagaagattcatatttggcagggat
tcaagcagaatctga

DBGET integrated database retrieval system