KEGG   Cucurbita maxima (winter squash): 111469728Help
Entry
111469728         CDS       T05246                                 

Definition
(RefSeq) mannose-1-phosphate guanyltransferase alpha-like
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
cmax  Cucurbita maxima (winter squash)
Pathway
cmax00051  Fructose and mannose metabolism
cmax00520  Amino sugar and nucleotide sugar metabolism
cmax01100  Metabolic pathways
cmax01110  Biosynthesis of secondary metabolites
Module
cmax_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    111469728
   00520 Amino sugar and nucleotide sugar metabolism
    111469728
Enzymes [BR:cmax01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     111469728
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 CTP_transf_3 Fucokinase
Motif
Other DBs
NCBI-GeneID: 111469728
NCBI-ProteinID: XP_022970896
Position
Unknown
AA seq 414 aa AA seqDB search
MESSEKVVAVIMVGGPTKGTRFRPLSFNTPKPLFPLAGQPMVHHPISACKRIPNLAQIFL
IGFYEEREFALYVSSLSNELRLPVRYLKEDKPHGSAGGIYYFRDIILEDSPSYIFLLNCD
VCCNFPLPDMLEAHKRYGGMGTILVNKVSAESANQFGALVADPVTNELLHYTEKPETFVS
DLINCGVYVFTSEIFGVIQDVSIHREGRANLRRVSSFEALQSATRNLPTDFVRLDQDILS
PLAGKKRLYTYETMEFWEQIKTPGMSLKCSGLYLAQFQLTSPHLLAGGNGTRTATIIGDV
YIHPSAKVHPTAKIGPNVSISANVRVAAGVRLISCIILDDVEIMENAVVINSIVGWKSSI
GKWSRVQANGDYNDKLGITILGEAVIVEDEVVVTNSIVLPNKTLNLSVLEEIIL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggagagctcggagaaagtggttgctgttatcatggtcggcggtccaactaaaggtact
agatttcggcctctttcattcaatactccgaagcctctcttccctctggctggtcaaccg
atggttcatcatcctatctctgcttgcaaacggataccgaatttagctcaaatttttctt
attggattttatgaggagagggaatttgctctttacgtttcttcattgtccaatgagttg
agactgccagtgaggtacttgaaggaggataaaccacatggctcggcaggaggaatttat
tacttcagagatattatcttggaagacagcccgtcatacatttttctattaaattgtgat
gtttgctgcaattttccgcttccagacatgcttgaggcacataagagatacggtgggatg
ggaactatattagtaaacaaggtttctgccgaatctgctaatcagtttggtgcactggtt
gctgatccggtcacaaatgagctgttgcattacacagagaaacctgagacttttgtgagt
gatttaataaactgtggtgtatatgtatttacctcggaaatttttggtgtcattcaagat
gtctcgattcatcgggaaggcagagcaaatctacgacgtgtctccagctttgaagctcta
caatctgcgacaaggaacctgccaacagactttgtgagattagatcaagatattttatcc
ccccttgctggaaagaaacgcttatatacatatgagaccatggaattttgggaacaaatc
aagactccagggatgtctttaaagtgttcgggcctttatctcgctcagtttcaattaacc
tctccccatcttttggctggtggaaatggtaccaggactgctactattattggcgatgtc
tacatacatccatcagcaaaagtacatcccactgcaaagattggtcccaatgtctctatt
tctgctaatgttcgcgtggctgctggtgtgaggcttataagttgcatcatcttggatgat
gttgaaattatggaaaatgctgttgtcataaattctattgttggatggaagtcatcaatc
gggaaatggtcacgtgtccaggcaaatggggactacaatgataagcttggaattacaatc
ctcggagaagctgtgattgttgaggacgaagttgtggttacaaacagcatagtcctccca
aataaaaccctcaacctcagcgtacttgaggagattattttataa

DBGET integrated database retrieval system