KEGG   Cucurbita maxima (winter squash): 111471023Help
Entry
111471023         CDS       T05246                                 

Definition
(RefSeq) glutamate-1-semialdehyde 2,1-aminomutase 2, chloroplastic-like
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
cmax  Cucurbita maxima (winter squash)
Pathway
cmax00860  Porphyrin and chlorophyll metabolism
cmax01100  Metabolic pathways
cmax01110  Biosynthesis of secondary metabolites
Module
cmax_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    111471023
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cmax01007]
    111471023
Enzymes [BR:cmax01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     111471023
Amino acid related enzymes [BR:cmax01007]
 Aminotransferase (transaminase)
  Class III
   111471023
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 111471023
NCBI-ProteinID: XP_022972470
Position
Unknown
AA seq 470 aa AA seqDB search
MAVTLAGFVGIGLPCATRLSRTSSRSARFGRVKMAVTFDEKKNFTLNKSEEAFNAAKELM
PGGVNSPVRAFKSVGGQPIIIDSVKGSHMWDIDGNEYVDYVGSWGPAIIGHADDEVLAAL
AETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGKEKL
IKFEGCYHGHADPFLVKAGSGVATLGLPDSPGVPKAATSETLTAPFNDIAAVEAIFNANK
GEIAAIILEPVVGNSGFIPPKPDFLNAIRKLTKENDALLIFDEVMTGFRLSYGGAQEYFG
ITPDLTTLGKIIGGGLPVGAYGGRREIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKRL
KEPGTYEYLDKITSELVEGLVTAGKKAGHAICGGYINGMFGFFFTDGPVHNFEDAKKSDT
AKFGRFHRGMLEQGVYLAPSQFEAGFTSLAHTSEDIQHTIAAAEKVFKQI
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcactcttgctggcttcgtcggaatcggccttccatgcgccactaggttatct
cgtacatcttcacggtccgctcgttttggccgtgtcaaaatggccgtcactttcgatgag
aagaagaatttcactctcaacaaatctgaagaggctttcaatgctgccaaggagcttatg
cctggtggagtgaattcccctgttcgtgccttcaaatctgttggtggacaaccaataatt
atcgattctgttaagggttcccacatgtgggatattgacggtaatgaatatgttgattat
gtgggttcttggggaccggcgattattggtcatgctgatgatgaggtacttgcagctcta
gctgaaacaatgaagaaaggaactagctttggtgctccatgccttttggaaaatgtttta
gctgagatggtgatatctgctgttccaagcatagaaatggttcggtttgttaactccggt
accgaagcatgcatgggcgtgcttcggcttgcccgtgcttttactggcaaggagaaactc
atcaaatttgagggatgctatcatggccatgctgatccgtttcttgtcaaggctggtagt
ggagtggcaacattgggccttcccgattctcctggcgtcccaaaagcagctacctcggaa
actcttactgcccccttcaatgacatagcagctgtagaagccattttcaatgccaataaa
ggagagattgctgcaattatccttgagcctgttgttggaaattctggtttcattcctcca
aaaccagattttctaaatgccatacgcaaactcaccaaggaaaacgacgctctcctcatc
ttcgatgaggtcatgacaggattccgcttgtcttacggtggagctcaggagtatttcgga
ataacacccgacttaacaacgcttggaaagatcattgggggcggtctacccgtaggtgca
tatggaggacgaagagagatcatggaaatggtagcaccagcaggaccaatgtaccaggca
ggcaccttgagtgggaatccattagcaatgactgcagggatacacacactaaagcgattg
aaagaaccaggaacctatgaatatctagacaagatcacgagcgaacttgttgaaggcttg
gtgactgccgggaagaaggcggggcatgcaatatgtggagggtacataaacgggatgttc
gggttcttcttcaccgatggtcctgttcataactttgaagatgctaaaaagagtgacact
gccaagtttgggaggtttcacaggggaatgttggagcaaggtgtataccttgcgccttca
cagtttgaggcagggtttaccagcttggcgcatacttctgaagatattcaacatactatt
gctgcagctgagaaggttttcaagcaaatttag

DBGET integrated database retrieval system