KEGG   Cucurbita maxima (winter squash): 111471802Help
Entry
111471802         CDS       T05246                                 

Definition
(RefSeq) polygalacturonase-like
  KO
K01184  polygalacturonase [EC:3.2.1.15]
Organism
cmax  Cucurbita maxima (winter squash)
Pathway
cmax00040  Pentose and glucuronate interconversions
cmax01100  Metabolic pathways
Module
cmax_M00081  Pectin degradation
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    111471802
Enzymes [BR:cmax01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.15  endo-polygalacturonase
     111471802
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_28 Pectate_lyase_3 NosD
Motif
Other DBs
NCBI-GeneID: 111471802
NCBI-ProteinID: XP_022973236
Position
Unknown
AA seq 429 aa AA seqDB search
MLITNPCVIKFSSALLVTFHVFLSLQLLFFNHALAAELTFNIISLGAKPDGKTDASSVLQ
MTWAKACDSSTPATIYVPDGIFYVRSVSFNGPCKNNVITVLIDGTLVASSDIQVLAKTKS
WIEFSHIDGLSITGGTIDGQGTALWNCKHSGKSCPVGATSLQINDAQNVNINGLSSINSQ
KFNIVVHGCQNVHMTRVNVSAADDSPNTDGIHVQQSSDVTILNSSISNGDDCISISPGTS
NLWMESITCGPGHGISIGSLGIKAEEDGVHNVTLTLSTFTGTQNGVRIKSWGRPSRGFAT
KVYFQHIIMDNVKNPIIIDQNYCPHETDCPGQASGVKVSEVTYEDIKGTSATEIAINFDC
SPINHCTGLSMKDINLTYENHIAKASCKNAEGTTSGVVEPSGCLADKSNFWQNVLVLRLK
DNKNALEGL
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgcttatcaccaacccttgtgtcatcaagttttcttccgctcttctagtaaccttccat
gtttttctttcccttcaacttctgttttttaaccatgccttggctgctgaattaacattc
aatattattagcctcggtgccaagcccgatggaaagaccgatgcctcgtctgtgcttcaa
atgacatgggctaaggcttgtgactcgtctacaccggccactatttacgttcccgatggt
atattctacgttcgaagtgtgagctttaatgggccttgtaagaacaatgttattaccgtt
ctcatcgatggaactcttgtggcttcctcggacattcaagttttagctaaaactaaatct
tggattgagtttagtcacatagatgggctttccattactggcggtactatcgatgggcaa
ggaactgccttatggaattgtaaacactcggggaagagttgccccgttggagccacgagc
cttcaaataaatgatgcacaaaacgtgaacatcaatggattatcttcgattaacagccaa
aagttcaacattgtggtgcatgggtgtcaaaacgtgcatatgacaagagtgaatgtctcg
gctgcagacgatagtccaaacactgatggcatccatgtgcaacaatcatcagatgtgacc
atcctcaattcgagcattagcaacggtgacgactgcatctcaatcagtccagggacctcc
aacttgtggatggaaagtattacatgcggacctggacatggaatcagcattgggagcttg
gggataaaggccgaggaggatggagtgcataacgttacactgacactatctactttcacc
gggactcagaatggagtaaggattaagtcttggggaagaccaagccgtggatttgctaca
aaagtttattttcaacacatcattatggataatgtgaaaaacccgatcataattgatcaa
aattactgtccacatgagacagactgtcctggtcaggcttctggagttaaagtcagcgaa
gtaacatacgaagacatcaagggaacttccgccactgaaatagcaatcaattttgattgt
agcccaataaatcattgcactggattaagcatgaaagacataaacctaacttacgagaat
cacatcgctaaagcttcatgtaaaaatgccgaaggaactacctctggtgtggttgaacct
tctggttgcttagcagacaaatctaatttttggcaaaacgtgttggtactaagattaaag
gataataaaaatgctctagagggcttataa

DBGET integrated database retrieval system