KEGG   Cucurbita maxima (winter squash): 111476631Help
Entry
111476631         CDS       T05246                                 

Definition
(RefSeq) rust resistance kinase Lr10-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
cmax  Cucurbita maxima (winter squash)
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cmax01001]
    111476631
Enzymes [BR:cmax01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111476631
Protein kinases [BR:cmax01001]
 Serine/threonine kinases: TKL group
  IRAK family
   111476631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like ABC1 DUF4748
Motif
Other DBs
NCBI-GeneID: 111476631
NCBI-ProteinID: XP_022976162
Position
Unknown
AA seq 450 aa AA seqDB search
MASMAAWLIGIIIVVCQVSTPSAQGGGGGNPMSIVIAFSVVGSVVGLLILVVIGIFSYKF
AKKVVREWRNTSTPPTDLESAPEEILEKDAPEMDKFLREIADEYPIRFTAQQLNVFTNNY
ATRLGSGGFGDVYKGQFPNGLKIAVKILKRNSDKKAENQFMAEIGTIGRTRHRNLLRMYG
FCYDEFMSALVLEYMENGSLDRFLYGKTRNEIDWEKLQEIATGTARGIAYLHEECHRRII
HYDIKPANILLDVDFSPKIGDFGLSNLCNRDNTHVSLTEYRGTPGYSAPELLRFNFPVTF
KCDVYSFGMVLFEMIGRRKNAEVSPSGSIDWFPIQIWERFDKGELVNMSGECNVEEDGER
KMAIERMCMVALWCVQDTPEDRPPMSAVVKMLEGSAEIMPPPKPFQYMYPISTDTSAVTA
VTVAMDSEQMSSGSSSSPIWYKGSVPILRT
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaatggcggcgtggttgatcggaataataatcgtagtctgccaagtctccacg
ccatcggcgcagggcggcggcggcggaaatccaatgtccatcgtaatcgctttctcggtg
gttggctctgtggttggattgctcattctcgtggtgattggcatattctcttacaaattt
gccaagaaagttgtaagagaatggagaaacacatcgactccaccgacggatctggaatcg
gcgccggaagagattttggaaaaagatgcaccggaaatggataaattcctccgagaaatc
gccgacgaatatccgattagattcaccgctcagcaactcaacgtcttcacgaacaactac
gcaacgcggctaggatccggcggcttcggtgatgtttacaaaggccagttccctaacgga
ttgaagatcgcagtgaagattctcaagagaaactccgacaaaaaagctgaaaatcagttc
atggcggaaatcggaacaatcggcagaacgcggcatcgaaatcttctcaggatgtacgga
ttctgttacgacgaattcatgagcgcgctggttttggagtacatggagaacggatcgctc
gacagattcttgtacggaaaaaccaggaacgaaatcgattgggagaaattgcaggaaatc
gcgaccggaaccgctagaggaatcgcgtatttgcatgaagaatgccatagaagaatcatc
cattacgatatcaaacctgcgaacattctattagatgtggatttctcaccgaaaatcggc
gatttcggactttcgaatctctgcaacagagacaacacacacgtatctctcacagaatat
cgaggaactccgggatattcagcaccggagctcttgagattcaattttccggtgactttc
aagtgcgatgtatacagtttcggaatggtgctgtttgagatgatcggaaggaggaagaac
gccgaagtcagtccgtccgggagcatcgattggtttccgattcagatatgggagcggttt
gataagggcgaactagtgaatatgagcggtgaatgtaatgttgaagaggatggagagagg
aaaatggcgattgaaagaatgtgtatggtggctctctggtgcgtacaggacacgccggag
gatcgacctccaatgtcggcggtcgtaaagatgttggaagggagcgctgaaataatgccg
ccgccgaagccgtttcaatatatgtatccgatttccacagatacaagcgccgtcaccgcc
gtcaccgtcgccatggattccgagcaaatgagctctggttcgagttcgagtccgatttgg
tacaagggctctgtccctattttgagaacttga

DBGET integrated database retrieval system