KEGG   Cucurbita maxima (winter squash): 111477244Help
Entry
111477244         CDS       T05246                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
cmax  Cucurbita maxima (winter squash)
Pathway
cmax00010  Glycolysis / Gluconeogenesis
cmax00562  Inositol phosphate metabolism
cmax01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111477244
   00562 Inositol phosphate metabolism
    111477244
Enzymes [BR:cmax01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     111477244
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     111477244
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 111477244
NCBI-ProteinID: XP_022977067
Position
Unknown
AA seq 490 aa AA seqDB search
MAGTKHIVMPIFLLVLLFLFTSSRAEQPPFSIKQHLSTVTRYSAANDGRNSNIAPAPDGC
VPIHLNLVARHGTRDPTKKRIRELNNLESQLDMLIRGSVGNDSSLRKVPSWFKGWKSPWR
GKVKGGGLIPEGEEELYYLGIRTRKLFSDLFSDDYSSEVYTIKATQVPRASASAVAFGMG
LFSGRGSLGSDRRRAFSVISESRASDTMLRFFDCCQKYEDYRKNQEPAVDKLKEPVLDDI
TKSLTERYGLNFTRLHISSLWFLCKQEASLLNITNQACGLFSPSEVALLEWTDDVELFIL
KGYGNSLNYKMGIPLLEDVVQSMKQAIKAKEEKLVLGSYEKARLRFAHAETVVPFTCLLG
LFLEGPDVGQTLREQPLQLPPQPPATRIWKGSTVAPFAGNNMLVLYNCPANLSDKYFVRV
LHNEEPITMPGCDNSDFCSFKVFMENIVAPHLEHDFDTLCTVDGEEPVLEPESSKLSLFH
WLFWLRNDNR
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaacgaagcacattgtaatgccgatttttcttctagttttattgttcttgttc
accagttcgagagccgaacaaccaccgttcagtataaagcaacatctgtccactgttacc
agatatagtgctgcaaatgatggtcgtaatagtaacattgctcccgctcctgatggatgt
gttccaattcatttaaatcttgtggctaggcacggaactcgagatccaaccaaaaaacgg
atcagagagttaaacaacttggaaagtcaattagacatgcttataagaggttctgtagga
aatgactcatctctgcgtaaagttccttcctggtttaagggatggaaatctccttggaga
ggaaaagtgaagggtggaggattaattcctgaaggagaggaagaattgtattatcttggg
atccgaacaagaaaattgttttctgacttgtttagtgatgattatagctcagaagtatat
acaattaaagcaactcaggttcctcgggcatcagctagtgctgtggcatttggtatgggg
ctatttagtgggagaggaagccttggatcagatcgtcgtcgagctttttctgtcatcagt
gagagtcgtgccagtgatacgatgcttaggttttttgattgttgtcagaagtacgaggat
tataggaagaatcaggaacctgccgttgataaactcaaggaacctgtacttgatgatata
actaagtcactcactgaacgttatgggctaaattttacccggctgcacatttcatcactt
tggtttctctgtaagcaggaggcatccttattgaacataacaaatcaagcttgtggactg
ttcagcccttccgaggttgctttgttggagtggacggatgatgtggagttgtttatattg
aagggttatggtaattcattaaactataaaatgggaattcctttgttggaagatgttgtt
caatccatgaagcaagccatcaaggccaaagaagaaaagctagttcttggcagctatgag
aaggcaagacttcgttttgctcatgctgaaactgtagttccattcacatgtttgctcggg
cttttccttgaaggacctgatgttggacaaacactaagggagcagcctttgcaacttcct
ccacagcctccagctactagaatatggaagggaagcaccgttgcaccttttgctgggaat
aacatgctggttctctataactgccctgctaacttgtcggataagtactttgtgcgagtt
ttgcataatgaagaacccataacaatgccgggttgtgacaattcggatttttgttccttc
aaagtgttcatggaaaacattgtggctcctcatcttgaacatgattttgacacattgtgc
actgtggatggggaagaacctgtgctggagcccgaatcaagtaagttatcactgttccat
tggctcttctggttgcgcaatgacaatagatga

DBGET integrated database retrieval system