KEGG   Cucurbita maxima (winter squash): 111481208Help
Entry
111481208         CDS       T05246                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase CYP57
  KO
K12737  peptidyl-prolyl cis-trans isomerase SDCCAG10 [EC:5.2.1.8]
Organism
cmax  Cucurbita maxima (winter squash)
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cmax03041]
    111481208
   03110 Chaperones and folding catalysts [BR:cmax03110]
    111481208
Enzymes [BR:cmax01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     111481208
Spliceosome [BR:cmax03041]
 Complex C
  Other components
   PPlases
    111481208
Chaperones and folding catalysts [BR:cmax03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    111481208
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 111481208
NCBI-ProteinID: XP_022982352
Position
Unknown
AA seq 493 aa AA seqDB search
MSTVYVLEPPTRGKVVLNTTCGPLDIELWPKEAPKAVRNFVQLCLEGYYDSTIFHRIIKD
FIVQGGDPTGSGTGGESIYGGVFPDEFHSRLRFKHRGLVACANAGSPHSNGSQFFITLSR
CDDLDKKHTIFGKVTGDSIYNLTSLGEFETDKDDRPVDPPKIKSVEVLWNPFEDIVPRAP
AKPGIPSTVDSDNKDIKKKAVKKLNLLSFGEEAEEDEKELAAVKKKIKSSHDVLDDPRLL
KDVIPSSELDNKRTREMQLSVRETLASKKQESRRDSDAENSNLPQYSDSDDDEANFDARM
RQQILRKRTELGVAPSHHKSKNGTSDSKNNEGSTQRSSAENTNREQPKVEKLSMKKKGIG
SEARAERMANADSDLQLLGEAERGRQLQKLKKRRLQGREDEVLAKLANFKKAISGKPTTS
SAESEGGNDELSDWKSAGLKFTPEPGKDRMTRSDDPNDYVVHDPLLEKGKEKFNKMQAKQ
KRREREWAGKSLT
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactgtttacgtgctagagccgccgacgagggggaaggtcgtattgaatacgacg
tgtggcccgctcgacatcgagctatggcctaaggaagctccaaaagccgtcagaaatttc
gttcaactctgtctcgaaggctattacgatagtaccatctttcaccggatcatcaaggac
ttcattgttcagggcggcgatcctaccggcagtggcacaggtggtgaaagtatctatggg
ggtgttttcccagatgagtttcactcacggctaagattcaagcacaggggcttagtagca
tgtgcaaatgctgggtcacctcattcaaatggaagtcagttttttataaccttgagtcga
tgtgatgaccttgacaagaagcacactatttttggaaaggtcactggggattctatatat
aatctaacaagtttgggtgagtttgaaactgacaaggatgaccgtcctgtggatccaccc
aagattaaatcagtcgaggtattatggaatccatttgaagatattgttccaagagcgcct
gcaaagcctgggatcccatccactgttgattctgacaacaaggacattaagaagaaagct
gtgaaaaaacttaatttactatcatttggagaagaagctgaagaagacgagaaagaactg
gcagctgtgaagaaaaaaattaagagcagtcatgatgtattggatgatccacgtctgctg
aaggacgtgattccaagcagtgaattggacaataaaagaacaagggagatgcagctatct
gttagagaaactttagcatcaaagaaacaagagtctcgtagagattcagatgctgaaaat
tctaacctccctcaatacagcgatagtgatgatgatgaagctaactttgatgcccgaatg
cgtcaacagatattaagaaaaagaacagagttgggagttgcaccatctcaccacaagtct
aaaaatgggacttctgactcaaagaataatgaaggatctactcaaaggtccagtgctgag
aacactaaccgtgagcaaccaaaggttgagaagttatctatgaagaaaaaaggaattgga
tctgaagcaagagcggagcgaatggctaatgctgactcggacttgcagttattgggtgaa
gctgaaagagggagacagctgcaaaaattgaagaagaggagactgcaaggacgtgaagat
gaagttttggccaaacttgcgaattttaagaaagccatttctggaaaaccaacaacttca
agcgccgaatctgagggtggcaatgatgagttgtcagactggaaatctgctgggttaaag
ttcacaccagaacctgggaaggaccgcatgactcgtagtgatgatccaaatgactatgtt
gtacatgaccctcttctcgagaaggggaaagaaaaattcaacaaaatgcaagccaaacaa
aagcgacgcgagcgggaatgggctggcaaatctcttacttaa

DBGET integrated database retrieval system