KEGG   Cucurbita maxima (winter squash): 111481968Help
Entry
111481968         CDS       T05246                                 

Definition
(RefSeq) lactosylceramide 4-alpha-galactosyltransferase-like
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
cmax  Cucurbita maxima (winter squash)
Pathway
cmax00601  Glycosphingolipid biosynthesis - lacto and neolacto series
cmax00603  Glycosphingolipid biosynthesis - globo and isoglobo series
cmax01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    111481968
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    111481968
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cmax01003]
    111481968
Enzymes [BR:cmax01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     111481968
Glycosyltransferases [BR:cmax01003]
 Glycan extension
  P blood group
   111481968
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug Caps_synth TcdA_TcdB
Motif
Other DBs
NCBI-GeneID: 111481968
NCBI-ProteinID: XP_022983362
Position
Unknown
AA seq 414 aa AA seqDB search
MSERCAITPILPAILLAAIIFLICGDCIIYKVSFPTVSIYEKNSSNSTIAHITQVHIEPT
LVGEPLQSSPNNRDDNDSETFDSLVIPSNLSGKKARIDWFRKHLPDFRILQSNNLTQKFH
DRFLEFLSQKCETQFFMTWVSPARSFRGRELMAVESVFKSHPRGCLTILSRTLDSERGCQ
ILKPLLDHGFKIQAITPDLPSLFKNTPVEVWFDELKRGKKDPGQIPLAQNLSNLMRLAVL
YKYGGVYIDTDFIVLKSFMGLKNSIGAQSIDPVSKNWRILNNAVLVFDKNHPLLEKFMED
FASNFDGSRWGYNGPFLVSRVMSKVTGATARLGFNVTVLPPAAFYPVDWTKIGELFKRPE
NRAAASWAKAKQAQINKEAYGIHLWNKQSKSHITQKGSVIERLFSDHCIICSYT
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaaaggtgtgctataacacccatattgccagccatcttgctcgctgccatcatc
ttcctcatatgtggagattgcataatctacaaagtttcctttccaacagtatccatatat
gagaaaaacagttcaaactcaacaattgcgcacatcacacaagtgcacattgagccaact
ttagttggagagccactgcagtcctcgccaaataacagagatgataatgacagtgaaact
ttcgattcgctagtaattccatccaatctttcaggaaaaaaggcaagaattgattggttt
aggaagcatcttcctgactttcggattttgcagtctaacaacttgacgcagaagttccac
gatcgatttctggagttcctcagccaaaagtgtgagacacagttcttcatgacatgggta
tctccagcaaggtctttcaggggcagagaattaatggcagtagaaagtgtttttaagtct
cacccacgtggatgcttaactattctatcaagaacactggattcagaaagaggctgccag
attcttaaacctctacttgatcatgggtttaaaattcaggcaataacaccggacttgcct
tcgctgttcaaaaacaccccggtggaggtttggtttgatgagttgaagagaggaaaaaaa
gacccaggtcagattcctttagctcagaatctatctaacctcatgagacttgcagtttta
tacaagtatggaggtgtttacatcgatacagattttattgttttgaagtctttcatgggt
ttgaagaactcaattggcgcacaaagtattgatccagtatctaagaactggagaatactg
aataatgctgttcttgtttttgataagaatcatccacttttagagaaattcatggaagat
ttcgcatcaaattttgatgggagcagatggggatataatggaccttttctggtctccaga
gtaatgtcaaaggtaacaggagccacagctagacttggtttcaatgtcaccgtattgcca
cctgcagcgttctacccagtggactggactaagattggtgaactttttaaaaggccagaa
aaccgagctgctgcaagttgggcaaaagcaaaacaagctcagataaataaagaggcttat
ggaatacacctatggaacaagcagagtaagagtcatataacgcaaaagggaagcgtgata
gaaagattattctctgatcattgcatcatttgcagctatacttag

DBGET integrated database retrieval system