KEGG   Cucurbita maxima (winter squash): 111482755Help
Entry
111482755         CDS       T05246                                 

Definition
(RefSeq) aldehyde dehydrogenase family 3 member F1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cmax  Cucurbita maxima (winter squash)
Pathway
cmax00010  Glycolysis / Gluconeogenesis
cmax00053  Ascorbate and aldarate metabolism
cmax00071  Fatty acid degradation
cmax00280  Valine, leucine and isoleucine degradation
cmax00310  Lysine degradation
cmax00330  Arginine and proline metabolism
cmax00340  Histidine metabolism
cmax00380  Tryptophan metabolism
cmax00410  beta-Alanine metabolism
cmax00561  Glycerolipid metabolism
cmax00620  Pyruvate metabolism
cmax00903  Limonene and pinene degradation
cmax01100  Metabolic pathways
cmax01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111482755
   00053 Ascorbate and aldarate metabolism
    111482755
   00620 Pyruvate metabolism
    111482755
  09103 Lipid metabolism
   00071 Fatty acid degradation
    111482755
   00561 Glycerolipid metabolism
    111482755
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    111482755
   00310 Lysine degradation
    111482755
   00330 Arginine and proline metabolism
    111482755
   00340 Histidine metabolism
    111482755
   00380 Tryptophan metabolism
    111482755
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    111482755
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    111482755
Enzymes [BR:cmax01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     111482755
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 111482755
NCBI-ProteinID: XP_022984451
Position
Unknown
AA seq 477 aa AA seqDB search
MDTHLEELRQSFRNGRTRSLEWRKKQLISLIQFIQDKENAIFEALFQDLGKHPVEIYRDE
VGIVLKSANNALSCLHKWIAPKKKYVPLLFFPAKGEVLPEPYGLVLIISSWNFPLSLALD
PLIGAISAGNTAVLKPSEYAPACSSLLAATLPLYLDDKAIKVVEGGADISEQLLQQKWDK
IFFTGSPSVAKIVMSEAAKHLTPVTLELGGKCPAIFDYSSVHSSMKVAAKRIVGGKWGPC
SGQACIGIDYLLVEDKFASELIESLKRVLKKFYGENSRNSTSIARIVNEKHVERISNMLH
DPKVAGCIVHGGLIDKQKLFIEPTILLNPPIDADIMTEEIFGPVLPIITLDNIEESIEFI
NARPKPLAIYAFTEDETLKKRIISETSSGSVTFNDTMVQFVCDSLPFGGVGQSGFGSYHG
KYSFDAFSHDKAVLQRSFLIELEPRYPPWNDFKLKFIRLAYRFDYFRLVLLLLGLKK
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggatacccatttggaggagctaaggcaaagcttcagaaatggaagaacaaggagctta
gaatggaggaaaaaacagctgatttcactgattcagttcattcaagacaaagaaaacgcc
atttttgaagctctcttccaagatcttgggaagcatcctgtcgaaatttatcgagatgag
gttggaatcgttttaaaatctgcaaacaacgctctctcttgtttacacaaatggatcgcc
cctaaaaagaaatacgtgccattactgttcttcccagcaaaaggggaagtgttgcctgag
ccatatggtctagtcctcataatttcatcatggaacttccccctttctttggcattggat
ccgttaatcggagcgatatcagcaggcaacacggcggttctaaaaccgtcggagtacgct
ccggcgtgctcgtctcttctcgctgcgacgcttcctctttacctcgacgataaagccatc
aaggtcgtggagggcggagctgatatcagtgaacagcttctgcagcagaagtgggataag
atcttcttcactggtagtccaagtgtagctaagattgtgatgtctgaagctgcaaagcat
ctaactcctgtaacattggagcttgggggaaagtgtcctgcaatctttgattactcctct
gttcattccagtatgaaggttgctgctaagagaattgtcggaggaaaatggggaccgtgc
tcgggtcaggcgtgtatagggatcgattacttgcttgtcgaggacaagtttgcttcagaa
ttgatcgagtcgttaaagcgagtgttgaagaagttttacggtgaaaactcgagaaattcg
acgagtatagctcggattgttaatgagaaacatgttgaaaggatcagtaatatgcttcat
gaccctaaggttgctggttgtattgtccatggtggtttaatagacaaacaaaaactcttc
attgagccgacaatattgttgaatcctccgatcgatgctgatatcatgaccgaagaaatc
ttcggtcccgtgctaccgataataacgttggacaatattgaagaaagcatcgagttcatc
aatgcaagaccgaaacctctagctatctacgccttcacagaagacgaaacgctaaagaaa
cggattatatccgaaacatcatcaggaagtgtcacgttcaatgataccatggttcagttt
gtgtgcgattcgctaccattcggcggtgtcggtcagagcggtttcggaagttaccatggc
aagtattcttttgatgcattcagccatgacaaagcagtgttgcaaagaagctttttgata
gaactcgagccacgatatccgccatggaacgatttcaagctcaagttcattagattggct
tatcgattcgactatttcaggctggtactactccttttggggttaaagaagtag

DBGET integrated database retrieval system