KEGG   Cucurbita maxima (winter squash): 111483829Help
Entry
111483829         CDS       T05246                                 

Definition
(RefSeq) uncharacterized protein LOC111483829 isoform X1
  KO
K21888  glutathione dehydrogenase/transferase [EC:1.8.5.1 2.5.1.18]
Organism
cmax  Cucurbita maxima (winter squash)
Pathway
cmax00053  Ascorbate and aldarate metabolism
cmax00480  Glutathione metabolism
cmax01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    111483829
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    111483829
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cmax02000]
    111483829
Enzymes [BR:cmax01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.5  With a quinone or similar compound as acceptor
    1.8.5.1  glutathione dehydrogenase (ascorbate)
     111483829
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     111483829
Transporters [BR:cmax02000]
 Other transporters
  Pores ion channels [TC:1]
   111483829
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C_2 GST_N GST_C GST_C_3 GST_N_4 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 111483829
NCBI-ProteinID: XP_022985936
Position
Unknown
AA seq 466 aa AA seqDB search
MAIEVAVKAAIGAPNVIGDCPFSQRVLLTLEEKKVPYKLHLINLSDKPIWFLEVSPEGKV
PVVKFDDKWVPDSDVIVGILEEKYPEPSLVTPPEFSSVGSKINGAFVKMLKSKDPNDGSE
LALLEELKALDEHLKAHGPYVAGEKVTAVDLSLAPKLYNLDIALGHFKKWIFPVNLNSLS
KYKELLFARESFMKTKAAPEHVISGWEPKVNAAAVPVISDSEPKVNAATEPVVSDSEPKA
NSVAEHVVSDCEPKAIEVAVKAAVGALDVIGDCPFAQRVLLTLEEKKVPYKWHLIDLSDK
PCWFLEVSPEGKVPVAKIDDRWVPDSDVIVGILEEKYPEPFLATPPEFSSVGSKINGAFV
KFLKSKDPSDGSEQALLEELKALNEHLKAHGPYVAGEKVTAVDLSLAPKLYHLDVALGHF
KKWIFPENLTSLSKYKELLFARESFVKTKAAPEHVISGWEAKVNDA
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggccattgaagttgctgtcaaggctgccattggtgcacccaatgtcattggagactgt
cctttctctcagagggttctcttaactttagaggagaagaaagttccatacaaactgcat
ctcatcaatttatccgataaacccatttggtttttggaagtgagcccagaagggaaggtg
cctgtggtgaagtttgatgacaaatgggttcctgattctgatgtcattgtggggattctt
gaggagaagtaccctgagccttctcttgttactccacctgaattttcttctgtgggatca
aagataaatggtgctttcgtgaaaatgttgaagagcaaggacccaaatgatggttcggag
ctggctttgcttgaagagttgaaggcgttggatgagcatcttaaggctcatggtccttat
gttgctggagagaaggtcactgctgttgatttgagtctggcaccaaagttgtacaatctc
gatattgctcttggccatttcaagaagtggatattccctgtaaacttaaacagtttatcc
aaatacaaagagttgcttttcgctcgagaatctttcatgaaaacaaaggctgccccagaa
catgtaatttctggttgggagcccaaggtgaatgctgctgcagtacctgtaatttctgat
agtgagcccaaggtgaatgctgccaccgaacctgtagtttcggatagtgagcccaaggct
aattctgtcgcagaacatgtagtttctgattgtgagcccaaggccattgaggttgctgtc
aaggctgctgttggtgcactcgatgttattggagactgcccttttgctcagagggttctt
ttgactttggaggagaagaaagttccttacaaatggcatctcatcgatttatccgacaaa
ccctgttggttcctggaagtgagcccagaagggaaggtgccggtggccaagattgacgac
agatgggttcccgactcagatgtcattgttggaattcttgaggagaagtatcccgagcct
tttcttgcgactccacctgaattttcttccgtgggatcaaagataaatggtgcttttgta
aaattcttgaagagcaaggacccgagcgatggttcggagcaggctttgcttgaagaattg
aaggcgttgaacgagcatctcaaggctcatggtccttatgttgctggagaaaaggttacc
gctgttgatttgagtctggcaccgaagctataccatcttgatgtcgcacttggccatttc
aagaagtggattttccctgaaaacttaaccagtctatccaaatacaaagagttgcttttc
gctcgagaatctttcgtgaagacgaaggctgccccggaacatgtaatttctggttgggag
gccaaagtgaatgatgcatga

DBGET integrated database retrieval system