KEGG   Cucurbita maxima (winter squash): 111484987Help
Entry
111484987         CDS       T05246                                 

Definition
(RefSeq) NADPH--cytochrome P450 reductase-like
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
cmax  Cucurbita maxima (winter squash)
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    111484987
Enzymes [BR:cmax01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     111484987
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 111484987
NCBI-ProteinID: XP_022987440
Position
Unknown
AA seq 708 aa AA seqDB search
MQSESSSMKASPFEFMSAIIKGRMDPSNSSFQSTAEGASVMFENRELVAILTTSIAVMIG
CFVVLVWRRSGNRKVKTVELPKPLITKGVEPEVEDGKKKVTIFFGTQTGTAEGFAKALSD
EAKARYDKAAFRVVDLDDYGADDDEYEQKLKNESIAVFFLATYGDGEPTDNAARFYKWFT
EGKERGEWLQNLNYAVFGLGNRQYEHFNKIAKVVDELLETQGGKRLVKVGLGDDDQCIED
DLAAWRELLWPELDQLLRDEDDATTVTTPYTAAISEYRVVFHDPAGVADENKNWMNANGH
AVHDAQHPLRSNVVVRKELHMPASDRSCTHLEFDISGSALKYETGDHVGVYCENLTETVD
EALNLLGLSPETYFSIHTDNEDGTPLVGNSLPPPFPSCTLRTALARYADLLNSPKKSALL
ALAAHASNPVEADRLRYLASPAGKDEYSQSIVGCQKSLLEVMVEFPSAKPPLGVFFAAVA
PRLQPRFYSISSSPLMAPSRIHVTCALVYDKMPTGRVHKGVCSTWMKNSVPMGKSDECSW
APIFVRQSNFKLPADSKVPIIMVGPGTGLAPFRGFLQERLALKESGVQLGSSILFFGCRN
RGMDYIYEDELNNYLETGALSELVIAFSREGPTKEYVQHKMAEKASDIWNLISQGAYLYV
CGDAKGMARDVHRTLHTIVQEQGSLDSSKAESMVKNLQMSGRYLRDVW
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcggaatccagttctatgaaggcttctccattcgagttcatgtcggccataatt
aagggcaggatggacccgtctaattcttcattccaatcgactgccgagggtgcctcggtt
atgttcgagaaccgcgagctggtggcgatcttaaccacatcgatcgccgtcatgattggc
tgcttcgttgttctcgtgtggcgaagatccggaaatcggaaagttaagaccgtggagctt
cctaagccgttgattacgaagggggtggagcccgaagttgaagacggcaagaagaaggtt
acaatattcttcggtacacagacaggcactgccgaaggctttgcaaaggctctatctgac
gaggcgaaagcacggtacgataaggccgcgtttagagttgttgatttggatgactatggg
gctgatgacgatgaatacgaacagaaattgaagaacgagtctattgcggtcttcttctta
gcaacgtatggcgatggagagcccactgataatgccgcaagattctataaatggtttacg
gaggggaaagagagaggggagtggctgcaaaacctcaattatgcagtctttggcctcggc
aaccgacaatatgagcattttaataagattgcaaaagtggtagatgagctgcttgagact
cagggaggcaagcgccttgtgaaagttggtcttggagatgacgatcagtgcatagaggat
gacttggctgcttggcgagaactgttgtggcctgagttggatcagttacttcgggatgag
gatgatgcaacgacagtgaccacaccttacacagctgccatatcagaatatcgagttgta
ttccatgatccagcaggtgtagctgatgagaacaagaactggatgaatgcaaatggccat
gctgtccatgatgctcaacatccattaagatctaacgtggttgtgaggaaggagctccat
atgcctgcatccgatcgctcttgtactcatctagagttcgatatttctgggtctgcactc
aaatatgaaactggggatcatgttggggtttactgcgaaaatttaactgagactgtggat
gaggcattgaacttattgggtttgtctcctgaaacgtatttctctatacatactgataac
gaggatggtaccccactagttggaaactctttaccacctccttttccatcatgcactctc
agaacagcattggctcgatatgcagatcttttgaattcacccaagaagtcagcgttgctt
gcattagcagcgcatgcttcaaatccggtagaggctgaccgattaagatatcttgcatca
cctgctggcaaggatgagtattcccagtctatagttggttgtcagaaaagcctgcttgag
gtcatggttgaatttccttctgccaagccaccacttggtgtcttctttgcagctgttgca
ccacgcttgcagcctcgattctactccatatcatcatctccattgatggctccatccaga
attcacgttacatgtgctttagtctatgacaaaatgccaacaggacgcgttcataaagga
gtttgctcaacttggatgaagaattctgtgcccatggggaaaagcgatgaatgcagttgg
gctccaattttcgtgaggcaatcaaacttcaagcttcctgcagatagtaaagtgcctatt
atcatggttggtcctggaactggattggctcctttcagaggtttcttacaggaaagatta
gctttgaaagaatctggtgtacaattggggtcttccatattgttctttggatgcagaaac
cgtggaatggattatatatacgaggatgagttaaacaactatcttgagactggtgctctc
tccgagttggttatcgccttctcacgtgaagggccaacaaaggaatatgtgcagcataaa
atggcagagaaggcttcagacatctggaatttgatatcacaaggtgcttatttatatgta
tgtggtgatgcaaagggcatggccagggatgtccaccgaactctccatactatcgtgcaa
gagcagggatctcttgacagctcaaaagctgaaagcatggtgaagaatctgcaaatgagc
ggaaggtatctgcgggatgtgtggtga

DBGET integrated database retrieval system