KEGG   Cucurbita maxima (winter squash): 111486983Help
Entry
111486983         CDS       T05246                                 

Definition
(RefSeq) probable mediator of RNA polymerase II transcription subunit 37c
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
cmax  Cucurbita maxima (winter squash)
Pathway
cmax03040  Spliceosome
cmax04141  Protein processing in endoplasmic reticulum
cmax04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    111486983
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111486983
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111486983
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cmax01009]
    111486983
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cmax03041]
    111486983
   03009 Ribosome biogenesis [BR:cmax03009]
    111486983
   03110 Chaperones and folding catalysts [BR:cmax03110]
    111486983
   04131 Membrane trafficking [BR:cmax04131]
    111486983
   03051 Proteasome [BR:cmax03051]
    111486983
   03029 Mitochondrial biogenesis [BR:cmax03029]
    111486983
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmax04147]
    111486983
Protein phosphatases and associated proteins [BR:cmax01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     111486983
Spliceosome [BR:cmax03041]
 Complex B
  Other components
   Prp19 complex
    111486983
 Complex C
   Prp19-CDC5 complex
    111486983
Ribosome biogenesis [BR:cmax03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    111486983
Chaperones and folding catalysts [BR:cmax03110]
 Heat shock proteins
  HSP70 / DNAK
   111486983
Membrane trafficking [BR:cmax04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    111486983
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    111486983
Proteasome [BR:cmax03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    111486983
Mitochondrial biogenesis [BR:cmax03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    111486983
Exosome [BR:cmax04147]
 Exosomal proteins
  Proteins found in most exosomes
   111486983
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 111486983
NCBI-ProteinID: XP_022989947
Position
Unknown
AA seq 648 aa AA seqDB search
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN
QVAMNPLNTVFDAKRLIGRRFTDPTVQNDMKMWPFKVIAGPGDKPMIVVNYKGEEKQFAA
EEISSMVLTKMREIAEAYLGSSVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
TAAAIAYGLDKKASSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRLVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY
TTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI
PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI
TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKLVQEAEKFKAEDEEHKK
KVESKNALENYAYNMRNTIRDEKIGGKLAPADKKKIEDAVEQAIQWLDGNQLAESDEFED
KMKELESICNPIIAKMYQGGADMGGGAMDDDTPPSGGSGAGPKIEEVD
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggcgggaaagggcgagggtccggccatcggtatcgatctcggtactacttattcctgt
gttggagtttggcagcacgatcgtgttgagattatcgccaatgatcaggggaatcggaca
acgccgtcgtatgttgctttcactgacagcgagcggcttatcggcgatgctgcgaagaac
caggttgccatgaatcctcttaacactgtcttcgatgcgaagcggttgattggaaggaga
ttcaccgatcccacggtccagaacgatatgaaaatgtggccgttcaaggtcatcgccggt
ccaggtgacaaacccatgattgttgtcaactacaaaggcgaagagaagcagttcgctgct
gaggaaatttcatccatggtcctcacgaaaatgcgtgagatagcagaagcttacctcggt
tcctccgtgaagaacgctgtcgttactgtccctgcttatttcaatgactctcagcgtcag
gccaccaaagacgcaggtgtcattgccggcctcaatgttatgaggatcatcaatgagccc
actgcggcagctatcgcttatggactagacaagaaagcatccagtgttggcgagaagaat
gtactcatatttgatttaggtggaggaacatttgatgtctctcttctcacaattgaggag
ggtatttttgaagtgaaggcaactgccggtgacacccatctcggaggtgaggacttcgac
aacagattggttaaccatttcgttcaggaattcaagaggaagcataagaaggacatcagt
ggaaatccaagggctctgaggagattgaggactgcttgtgaaagggcgaagagaaccctt
tcatccactgctcaaactacaatcgagattgattctttgtatgaaggaattgatttctac
acaaccatcactcgtgctagattcgaggagctcaacatggacctgttccggaagtgtatg
gagccagttgagaagtgtctgagagatgcaaagatggacaaaagcagcgtccatgatgtt
gtccttgttggtggctctacgaggattcctaaggtgcagcagctactgcaggatttcttc
aatggcaaggagctctgcaagagtatcaatcctgacgaggcagttgcttacggggctgct
gttcaagctgctatcttgagtggtgagggaaatgagaaagtgcaggatcttcttcttttg
gatgtcactcctctgtctcttggcttagagactgctggaggtgtgatgacagttttgatc
ccaaggaacaccaccatacccacaaagaaggagcaagtattttccacatactcagacaac
cagcctggtgttcttattcaggtctacgagggtgagagaacaagaaccagggataacaac
ttgctgggcaagtttgaactttccggcattcctccagctccaagaggtgttcctcagatc
accgtttgcttcgacattgacgccaacggtattctaaacgtttctgcagaggataaaaca
actggacagaagaacaagatcaccattaccaacgacaaaggaaggttgtccaaagaggag
attgaaaaactggttcaagaagcagagaagttcaaggctgaagatgaggaacacaagaag
aaagttgaatcgaagaatgctttagagaactatgcatacaatatgaggaacactatcaga
gatgaaaagataggtggtaaacttgccccagcagacaagaagaagattgaagatgcagtt
gagcaggccattcaatggctagacggcaaccagcttgcagagtctgatgaatttgaggac
aaaatgaaagaactcgaatccatttgcaaccccatcatagccaagatgtatcaaggtggg
gctgacatgggcggcggcgcaatggacgatgatactcctccatcaggcggcagtggcgct
ggtcctaagattgaggaagttgattaa

DBGET integrated database retrieval system