KEGG   Cucurbita maxima (winter squash): 111488643Help
Entry
111488643         CDS       T05246                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: G-type lectin S-receptor-like serine/threonine-protein kinase CES101
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
cmax  Cucurbita maxima (winter squash)
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cmax01001]
    111488643
Enzymes [BR:cmax01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111488643
Protein kinases [BR:cmax01001]
 Serine/threonine kinases: TKL group
  IRAK family
   111488643
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Haspin_kinase DUF3403
Motif
Other DBs
NCBI-GeneID: 111488643
NCBI-ProteinID: XP_022992272
Position
Unknown
AA seq 403 aa AA seqDB search
MFLLLCFMSYVKWRTQILKVIRKMKKGFIRGIGAISEGFTILGIMTRQIRDGKKNPELQF
FDFESIVSATNNFAEDCKLGQGGFGPVYKGVLGDGLEVAIKRLSKNSGQGLEFKNETILI
AKLQHTNLVRLIGCCIDREEKLLVYEYMPNKSLDSFLFDSEKKLILDWDKRFHIIQGIVQ
GLLYLHYYSRVRKIHRDLKVSNILLDNEMNAKISDFGMARVFKPSEHEANTSRVVGTYGY
ISPEYAMEGIFSIKSDVYSFGILLLEIITGKKNYNNYDTERPLNLIGYAWELWVNGRGEE
LIDSDFCNSDQKPKVLRCIHVGLLCVQQAPADRPTMLDVYLMINNDSTQVLPPKQPAFFI
SQNPNSSELEPEVVDSGRLIRPAQPPQEICSLSTMSVSVMVAR
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcctactctgttttatgtcctacgtcaaatggaggacacaaatattgaaagtt
atcagaaaaatgaagaaagggttcattcgcgggataggtgctatatccgaaggtttcacc
attctaggaataatgacaagacaaattcgagatggcaaaaagaatcctgaattacagttc
ttcgacttcgaaagcatagtttctgccacaaacaattttgcagaggactgtaagctggga
caaggtggttttgggcctgtttataagggagttttgggtgatggcctagaagtagccatt
aaaagactgtcgaagaattctgggcaaggattggagttcaagaatgaaactattttgatt
gccaaacttcaacacacaaatctggttaggctgattggttgctgcattgatagagaagag
aaattgttggtgtacgagtacatgcccaataaaagccttgactccttcctctttgactcg
gagaagaagttaatattagactgggacaagcgttttcacataatccaagggatagttcaa
ggactactctaccttcactactattcaagagtacgaaaaattcatcgagatttgaaagtt
agcaatatcctactagacaatgagatgaatgcaaaaatatcagattttggtatggctagg
gtgtttaaaccatccgagcatgaagcaaacacaagtcgggtggttggaacatatgggtat
atatcaccggaatatgcaatggagggcattttctcgataaagtcagacgtgtacagtttt
ggaatattattgttggagatcataacaggcaaaaagaactataacaattatgacacagaa
cggcctttgaatctcataggatatgcgtgggagctgtgggtgaatgggagaggagaagag
ctgattgattcggatttttgcaactctgatcagaaaccaaaagttctaagatgcatccat
gtgggtcttttgtgcgtacaacaagcaccggcagacaggccgacgatgctggatgtttat
ctaatgattaacaatgattctactcaagttctacctcccaagcagcctgcattcttcatt
tctcaaaacccaaactcgtcggagcttgaaccggaggtggtcgacagtgggcggctcata
cggcctgcacagccaccacaggaaatttgttcattgagtactatgtcagtctcggtgatg
gtggccaggtga

DBGET integrated database retrieval system