KEGG   Cucurbita maxima (winter squash): 111488697Help
Entry
111488697         CDS       T05246                                 

Definition
(RefSeq) protein PHYLLO, chloroplastic isoform X1
  KO
K14759  isochorismate synthase / 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase / 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase / O-succinylbenzoate synthase [EC:5.4.4.2 2.2.1.9 4.2.99.20 4.2.1.113]
Organism
cmax  Cucurbita maxima (winter squash)
Pathway
cmax00130  Ubiquinone and other terpenoid-quinone biosynthesis
cmax01100  Metabolic pathways
cmax01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    111488697
Enzymes [BR:cmax01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     111488697
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     111488697
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     111488697
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     111488697
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N MR_MLE_C TPP_enzyme_M_2 Abhydrolase_1 Abhydrolase_6 TPP_enzyme_C Thioesterase Hydrolase_4 Abhydrolase_2 Abhydrolase_3 Lipase BAAT_C DUF2974 DLH Esterase DUF900
Motif
Other DBs
NCBI-GeneID: 111488697
NCBI-ProteinID: XP_022992371
Position
Unknown
AA seq 1731 aa AA seqDB search
MKADTLSIHKPALPHPVRPFNRASFPRSILFSTFGFIPKPSRHPGSFRLPQTSCFKGVRY
DSPVMGATELSELEDVELMVEMCITHTLPPSLTLKQGLESISEAIEKLKLESPRSSDGVF
RFQVAVPPSARALMWFCCQPESSEVYPIFFLSKEKDATIKSLYLNDTRGVFGIGTAIYFA
SLSSTSSKQCTLKRYLMNDSAPIMAYGFVNANTGETSSLKNEAGHSYFCVPQIELNEYEG
VSVLSATLAWSEAFPCTFEEALHSLGSSIYQIGTNFPSRENFQYKYIRSSLTASNHVDVT
NQMGYMKVFSVAGESFRTGIMEMKESARSHQFCIRLSPSVAVACNMLDRTNETCLSEQEH
ANINALWASFIVEECSRLGLTYFCIAPGSRSSLLAIAAASHPLITCISCFDERSLAFHAI
GYAKGSHSPAVVITSSGTAVSNLLPAVVEASQDFLPLLLLTADRPLELQEAGANQAINQV
NHFGSFVRFFFSLPAPTDEIPARMVLTTLDSAVNWATSSPCGPVHINCPFREPLENSSPW
NLSSLNGLQSWLSSSEAFTKYIRLEASPMSIDTFGHMAEVLKVIHGARNGILLLGSIQSE
DEIWAAFLLAKHISWPIVADVLSGLRLRKSLSSFLEVENNFFFVDHLDHALLSDSVRKWL
KFDVIIQMGSRVTSKRVSKMLEDCSPCSYIMVDEHPGRHDPSHIVTHRIQSTVLEFVGCL
LKTGFPRNRSKWTATLQALNMMVEWEIQFQISANYCLSEPQVAQVISEALPFDSVLFLGN
SMPIRDVDMYARGWSKCTDSVAARPLNLQLPFCWTWTSGNRGASGIDGLLSTAVGFSVGC
NKRVLCVVGDVSFLHDTNGLAILNQRMTRKPVTVVVINNNGGAIFSLLPIKDKVEAAILD
QFFHTSHKISLRSLCVAHGLKHLHVRTKMELQDALFMSQCEENDCIIEVESSIDANTSFH
SVLRKFTCQAVDHGLRIFSRLYFEESVSPGLFLCKISRMEYTLFRIPLCAPPTTSSSSID
QINRGFFREGFILSLFLEDGSLGLGEVSPLEIHKENLLDVEEQLKCLLHILKGAKISSSI
PLLRGSFSSWIFHELGIPPRSIYPSVRCGLEMAILNAIAGRKGCSLLDVLQHRLVEEDDL
SSSSKVKICGLLDSGGTPSEVARVAKTLVKEGFPAIKLKVARQGNVMYDAAVVQEVRKKL
GNQIELRVDANRNWSYEEAILFSSLVKDCGLQYIEEPVMDEDAIVKFCKESGLPVALDET
IDGIQDNPVKELAKYVHPGIVAIVIKPSVIGGFENAALVARWAQQHGKMAVVSSAFESGV
GLSGYIHLSCYLELQNAEIRKLMDIQPAPSIAHGLGTFRWLDEDVTVNPLRIGRDPHSGI
IEASAAEANRLLKSFQINQKFVRRKFTEEQVRRYKLTVDSKGFSYLIKVLEVGQRTNDNV
LLFLHGFLGTGEDWITIMKAISGSARCISIDLPGHGESTTQKNDCDVHGVEEPNFSMEVV
ANLLYKLIHHLAPGKVNLVGYSMGSRIAMYMALRFADKIGRAVIISGSPGLKDKMARRIR
RVKDDSRARILKAYGLESFLEAWYSGELWKSFREHPHYSQIIASRSKHDDVQHLAKALSD
LSIGRQPQLWDELKCCKTPLSIIVGEKDTKFKTIAQQILSQIDMGRKIKDEPVVDLHEIV
EIPDSGHAAHLENPLAVINALSRFLIRSRKQFSYNSDFSGQVAITHESHLL
NT seq 5196 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgacactctaagcatacacaagcctgctcttccccacccagttaggcctttc
aatagagcttctttcccgcgctcaattctcttctctactttcggtttcattcccaaacct
tcccgccatccgggttcctttcgcttgcctcagacctcctgcttcaagggtgtgcgatat
gacagtccagtaatgggcgcaacggagttatccgagcttgaagatgtggaattgatggtg
gagatgtgcattacacatacactgccaccgtctctgacgcttaagcaggggctggagagt
atcagtgaggctattgaaaagttgaagttagaatctccacgttcttccgacggagttttc
aggtttcaggtggctgttcccccgagtgcaagagctcttatgtggttttgttgtcaacca
gagtcatctgaagtgtatcctatctttttcctttccaaggagaaggacgcaacaattaag
tcactgtacttgaatgatacccgcggtgtttttggaattgggactgcaatttactttgct
agcttgtcttctacttcatcaaaacaatgtacattgaaaaggtatctcatgaatgattca
gctcctattatggcttatggttttgttaatgctaataccggggagacatcttcactgaag
aacgaggctggtcattcatacttttgcgttcctcaaattgagttgaatgagtacgagggc
gtttctgttctctctgcaacacttgcatggagtgaagctttcccttgtacatttgaggaa
gctcttcattctttggggtcatctatctaccagattggtactaattttccatctagagaa
aacttccagtacaaatatataagatcttctttaacagcttcgaatcatgtggacgtgaca
aatcagatgggatacatgaaagtattttctgtggctggcgaaagcttcaggactggcatc
atggaaatgaaggagtctgcacgctcccatcaattctgcattcggctttcaccaagtgtt
gccgttgcatgtaatatgttggatcgtaccaacgaaacttgtctctcagagcaagagcat
gccaacattaatgctctctgggcatcgttcatagttgaagaatgttctcgtcttggtttg
acgtatttttgcatagctcctggatcaagatcgtcccttcttgccattgctgctgcaagt
catcccctgataacatgtatttcttgctttgatgaacgctctcttgcttttcatgcgatc
gggtacgcaaaaggatctcatagcccagcagtcgtaatcacatcatcaggcactgctgtt
tcgaatcttctgcctgctgttgttgaagctagtcaagattttcttcctcttctattgctc
acagctgaccgccccctggagctgcaagaagcaggagcaaatcaagctattaatcaggta
aaccattttggttcatttgtgaggttcttcttcagtcttcctgccccaactgatgaaatt
cccgccagaatggtgcttaccactcttgattctgctgtaaattgggcaacctcttcgcct
tgtggccctgttcacataaattgtccatttagggagccactggaaaatagtagtccatgg
aatttgagttccttaaatggattacaaagttggttatcaagcagtgaagcttttaccaaa
tatattcgactcgaagcatctccaatgtctattgatacttttggccatatggcagaggtt
ttaaaagtaatccatggagccagaaatggaattctacttcttgggtcaattcaatcagag
gatgagatatgggctgcttttctgttggccaaacatatttcatggcctatagtagctgat
gtattgtctggtttacgattgagaaagagcttgtcttccttcctagaagtggaaaataac
tttttctttgtcgatcaccttgatcatgccttgctttctgattcagtgagaaaatggcta
aaatttgacgtgattattcagatgggaagcagggtaacaagcaaacgtgtttcaaagatg
ctagaggactgcagtccctgttcatacatcatggttgatgagcatccaggtcgtcatgat
ccatcgcatattgtgacacatagaattcaaagcaccgtcttagaatttgtgggttgctta
cttaaaactggttttcctcgcaataggagcaagtggactgctactctacaagcattgaat
atgatggtggagtgggaaatacaatttcaaatttctgctaactactgtctatctgagcca
caagttgctcaggtaatctcagaggcacttccatttgattctgttctgttcttggggaat
agcatgccaatccgtgatgttgatatgtatgcacgtggttggtcaaaatgcaccgacagt
gtagcggctagaccattaaacttacaactgccattttgctggacatggacttctggaaat
aggggagccagtggtattgacggacttctaagcacagctgttggtttctctgttggctgc
aacaaacgagtgctttgtgtagtcggagatgtttctttccttcatgatacaaatggcttg
gcaattttgaaccagaggatgacgaggaaaccagtgactgtagttgtaatcaataataat
ggtggggcaatctttagtctcctccctatcaaggacaaagtagaggcagcaatactagac
cagttcttccacacctctcacaagatttcactccgtagcctatgtgtggcacatggcctg
aagcatttacatgtacggacaaagatggaactccaagatgctttatttatgtctcaatgt
gaagaaaatgactgcataatcgaggtcgaaagttccattgatgccaatacttccttccac
agtgtcttgaggaagttcacttgtcaagcagtagaccatggtttacggatcttttcaagg
ctttattttgaagaatctgtttcacctggactcttcctttgcaagataagtagaatggaa
tacacattgttcagaatccctctatgtgctccacctacaacctcatctagttctattgat
caaatcaatcgggggttcttcagagaaggttttattttgtctttgtttcttgaggacgga
agtcttgggcttggtgaggtttcaccccttgaaattcacaaagagaacctactagatgtg
gaagagcaacttaagtgtcttcttcatatattaaagggagccaagatcagcagctccatt
cctttactacggggctcattttcatcttggattttccatgaactgggaatacctccacgt
tcgatctatccaagtgttagatgtggcttggaaatggctattcttaatgccatagcaggg
agaaaaggttgcagcttgttagatgtactccagcatcggttagttgaagaagacgacttg
tcatcttcgtcaaaagttaaaatttgtgggctgttggattctggtggaactccatctgag
gtagctcgtgttgctaagacactggtcaaagaaggatttcctgctatcaagttaaaggta
gcccgacaagggaatgtcatgtatgatgctgcagttgtacaggaagtaaggaagaagctt
ggcaaccagattgaactccgtgttgatgccaatcggaattggagctatgaagaagctatt
ttatttagctctttggtgaaggactgtggcttgcaatatattgaggaaccagttatggat
gaagatgctattgttaaattctgtaaagagagtggtttgcctgttgcactggatgaaact
atcgatggtattcaagataatcctgtgaaagaacttgcaaagtatgttcatcccggaatt
gttgctatagttataaaacccagtgtcattggcggatttgaaaatgcagcattagtagca
aggtgggcacagcaacacggaaaaatggctgttgttagttctgcatttgaaagtggtgta
ggtttgtctggatacatacacttatcctgttatctggagcttcagaatgcagaaataaga
aaactgatggatattcaaccagctccatctatagcccacggtctaggaactttccgttgg
cttgacgaagatgtaactgtcaatcctctcagaattggtcgtgaccctcatagtggcatt
atagaagcatctgctgctgaggctaatcgacttctaaaaagttttcaaatcaaccagaag
tttgttcgtagaaagtttactgaagagcaagttcgtaggtacaaattaactgtagactca
aaggggttctcttatttaataaaagttctagaggttggacaaagaacaaacgataatgtg
ctattatttcttcatggatttcttgggactggtgaagactggattacaatcatgaaggcc
atctcaggttcagctagatgcatttctattgaccttcctggtcatggggaatcaacaaca
caaaagaatgattgtgatgttcatggtgtggaggaaccaaatttttctatggaggttgtt
gctaatctactgtataagttgattcatcatcttgctcctggtaaagttaacctcgtaggg
tattcaatggggtctaggattgccatgtacatggccctgagatttgctgataagattgga
agagctgttataatatctggaagccctggattaaaagacaagatggcaagaagaatccgg
agagttaaagatgattctagagcacgaatccttaaggcctatggtttagagagctttctt
gaggcatggtatagtggggaactatggaaaagtttcagagaacatccacattatagtcaa
attattgccagccgatcgaagcatgatgatgtgcagcatcttgcaaaagctctgtctgat
ttaagcattggaaggcagccgcaattgtgggatgaattaaaatgctgcaaaacacctctt
tcaatcattgttggggagaaggatacaaaattcaagacaattgcacagcaaattctatct
caaattgatatgggcaggaagatcaaggatgaaccagttgttgacctccatgaaatagtc
gagatcccggactcaggacatgctgcccatctggagaatcctcttgctgttatcaatgca
ttaagtagatttctaataaggagtagaaaacagttctcctacaattcagatttctcaggc
caagtcgcaattacgcatgagagccaccttttgtaa

DBGET integrated database retrieval system