KEGG   Cucurbita maxima (winter squash): 111489987Help
Entry
111489987         CDS       T05246                                 

Definition
(RefSeq) probable phosphopantothenoylcysteine decarboxylase
  KO
K01598  phosphopantothenoylcysteine decarboxylase [EC:4.1.1.36]
Organism
cmax  Cucurbita maxima (winter squash)
Pathway
cmax00770  Pantothenate and CoA biosynthesis
cmax01100  Metabolic pathways
Module
cmax_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    111489987
Enzymes [BR:cmax01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     111489987
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-GeneID: 111489987
NCBI-ProteinID: XP_022994166
Position
Unknown
AA seq 213 aa AA seqDB search
MAYPEPASVEREVMQVNNALRKPRILLAAGGSVASIKFGNLYHSFSEWADVRAVATRAAL
HFIDRESLPKDAVLYTDEDEWTGWNKIGDSVLHIELRRWADIMVIAPLSANTLGKIAGGL
CDNLLTCVVRAWDYNKPLFVAPAMNTYMWTNPFTERHLIAIDELGITLIPPVTKRLACGD
YGNGAMAEPSLIFSTVRLFYESRMQQSTRNGDS
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggcatatccagagcctgcaagtgttgaacgagaggtgatgcaagtcaacaatgctctg
aggaaaccgaggattttacttgctgccggtggaagcgtagcttcaattaagtttgggaat
ctctaccattctttctctgaatgggcggacgttagagcggtggctactagggccgcttta
cacttcatcgatcgagaatctcttcctaaggatgctgtactctataccgatgaagatgag
tggactggttggaacaaaattggtgatagtgttcttcatattgagcttcgccggtgggct
gatatcatggtcattgcccctctgtctgcaaacacgctcggcaagattgctggaggatta
tgtgacaatctattgacgtgtgtcgtgcgagcatgggactataacaagccacttttcgtt
gcaccagccatgaatacctatatgtggactaacccttttactgagcggcatctcattgca
attgatgaacttgggataactctcattccacccgttaccaagaggctagcctgtggggac
tacggcaatggtgcaatggctgaaccttccttaatcttctcgactgtgagactcttttac
gagtcacggatgcaacaaagtactagaaatggtgatagttag

DBGET integrated database retrieval system