KEGG   Cucurbita maxima (winter squash): 111490037Help
Entry
111490037         CDS       T05246                                 

Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
cmax  Cucurbita maxima (winter squash)
Pathway
cmax00020  Citrate cycle (TCA cycle)
cmax00640  Propanoate metabolism
cmax01100  Metabolic pathways
cmax01110  Biosynthesis of secondary metabolites
cmax01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111490037
   00640 Propanoate metabolism
    111490037
Enzymes [BR:cmax01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     111490037
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     111490037
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 111490037
NCBI-ProteinID: XP_022994240
Position
Unknown
AA seq 341 aa AA seqDB search
MGCQAVAKLIGSAINRKASSSSSSSLFSQAASQIRHYAAAPPPPPAVFVDKNTRVICQGI
TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPPP
FAAAAILEAMEAELDLVVCITEGVPQHDMVRVKAALNKQSKTRLIGPNCPGIIKPGECKI
GIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIEKF
LADPQTEGIVLIGEIGGTAEEDAAALIKESGTEKPIVGFIAGLTAPPGRRMGHAGAIVSG
GKGTAQDKIKTLREAGVTVVESPAKIGVAMLDVFKQRGLVS
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgggttgtcaagccgttgccaagctcataggatcggccattaatcgaaaagcttcttca
tcttcatcatcctccttgttttcgcaggcggcgtcgcagattcggcattacgcagctgca
ccgccaccaccgccggcggtattcgtagataaaaacactcgcgtcatatgtcaagggatc
actggtaaaaatggtaccttccacactgagcaggcaatcgaatatggcacgaaaatggtc
ggtggtgtaacgcccaagaagggtggaaccgaacacttgggtctccctgtttttaacaca
gtcgctgaagccaaagctgaaacgaaggccaatgcatcagtaatttatgtccctccgccg
tttgctgcagcagctatcttggaggcgatggaagctgagctagatcttgtagtttgtata
acggaaggggtcccacagcatgatatggtaagagttaaggctgctttaaacaaacaatct
aaaactaggttgattggccctaactgccctggtattatcaagcctggagagtgtaaaatt
ggaattatgcctgggtacatccacaaacctgggcgcattggcattgtatcacgatctggc
accttgacctatgaagcggttttccaaactactgctgttggccttggacaatccacgtgc
gtaggtattggaggggatcccttcaacgggacgaactttgttgattgcattgagaagttc
cttgctgatcctcagacagaaggtattgttctaattggagaaattggtgggactgcggaa
gaggatgctgctgctttgataaaggaaagtgggactgagaagcctatcgttggcttcatt
gctggccttactgctcccccaggccgtcgcatgggtcatgctggtgcgattgtttcgggt
ggaaaaggtaccgcccaagacaaaatcaagacactgcgagaagctggagtaacagtggtg
gagtcgcctgcgaaaattggcgttgcaatgcttgacgtcttcaaacagagaggccttgtc
agttaa

DBGET integrated database retrieval system