KEGG   Cucurbita maxima (winter squash): 111490965Help
Entry
111490965         CDS       T05246                                 

Definition
(RefSeq) probable serine/threonine-protein kinase PBL3 isoform X1
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
cmax  Cucurbita maxima (winter squash)
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cmax01001]
    111490965
Enzymes [BR:cmax01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111490965
Protein kinases [BR:cmax01001]
 Serine/threonine kinases: TKL group
  IRAK family
   111490965
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 111490965
NCBI-ProteinID: XP_022995417
Position
Unknown
AA seq 385 aa AA seqDB search
MGICCAKPAKLAHASSTNISARDNLNSKSNVGSTDSSQKTLSLTSSTSVIKPKFDVSGAC
ALKSFSFIDLRNATKNFRSESLLGEGGFGCVFKGWIDEHTYLPTKPGTGIVVAVKKLKRG
SLQGYKEWLAEVNYLGQLRHDNLVRLIGYCSESDDRLLVYEYMPKGSLENHLFRKGVAPI
SWRVRMNIAVDVARGLSFLHSCQPNVIYRDLKASNILLDSEFNAKLSDFGLAREGPTGDK
THVSTRVMGTRGYAAPEYVATGHLTPKSDVYSFGVVLLELLSGKRALDQEKVGRVEETLV
DWGKPLLSDSKRMLRIMDTRMGGQYSRKEAQAAASLALNCLHTDPKNRPSMVDVLEELER
LLSSKDVLRTPDSRAIRRTPPARSR
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgggaatctgctgcgcaaaacctgccaagctcgctcatgcatcttcaaccaatatttct
gcaagggataacttaaatagcaagtcaaacgttggatcaactgattctagtcagaaaact
ctgagtcttacctctagtacgtctgtaatcaaaccgaaattcgatgtatctggcgcctgc
gctctcaagtcttttagcttcattgatctcaggaatgccaccaagaacttccgcagtgaa
agtctacttggtgagggaggatttggatgcgtcttcaaagggtggatcgatgaacacaca
tatcttcctactaaacccgggactggaattgtggtggctgtcaagaaactcaagcgaggg
agccttcaaggctacaaggagtggcttgcggaagtgaactatctgggccagctccgccat
gataatcttgtcaggcttattgggtattgctcagagtccgatgacagacttctagtttat
gagtatatgccgaagggaagcctggaaaaccatttgtttagaaaaggtgttgcaccgatt
tcttggcgtgttcgaatgaatattgcagttgatgtggcacggggattatcgttcttacac
agttgtcaacctaatgttatataccgagatttgaaggcgtccaacattctgcttgattca
gaattcaatgccaaactctcagattttggcttagcaagggagggtcctacgggagacaag
actcatgtttcaacccgggttatgggaactcgaggctacgctgccccagaatatgtagca
acaggtcacttgaccccgaagagtgacgtatacagctttggcgtcgttttgctagaacta
ctctcgggcaaacgtgcattggaccaagagaaagtggggagagtggaagagaccctagtg
gattgggggaaaccccttctaagcgacagtaaacgaatgttgaggataatggacacgagg
atgggcggtcagtactcgagaaaagaagctcaagctgcagcctcgcttgcgctgaattgt
ctccacacagatcctaaaaacaggccatcaatggttgatgttctggaggaattagaacga
ctactgagctcaaaggatgttctaaggactccggacagccgtgccattagacgcactccg
cctgctagatctcgatag

DBGET integrated database retrieval system