KEGG   Cucurbita maxima (winter squash): 111493520Help
Entry
111493520         CDS       T05246                                 

Definition
(RefSeq) probable glycosyltransferase At3g42180 isoform X1
  KO
K18789  xylogalacturonan beta-1,3-xylosyltransferase [EC:2.4.2.41]
Organism
cmax  Cucurbita maxima (winter squash)
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cmax01003]
    111493520
Enzymes [BR:cmax01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.41  xylogalacturonan beta-1,3-xylosyltransferase
     111493520
Glycosyltransferases [BR:cmax01003]
 Polysaccharide
  Structural polysaccharide
   111493520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exostosin Orbi_VP4 DUF4326
Motif
Other DBs
NCBI-GeneID: 111493520
NCBI-ProteinID: XP_022998992
Position
Unknown
AA seq 458 aa AA seqDB search
MASFRCLLLPACLLLLLLLFVLLFLSIPPLLDLSQVTEAIPLASFFPITTMREGNKPMKA
IFIKQKKKTSLRMIEASLAEARASIRNAVRWKNFTSEKKETYIPRGSIYRNPYAFHQSHI
EMVERFKVWSYREGEQPLVHDGPLNSIYAIEGQFIDELDCSKSPFRASHPDQAHVFLLPM
SITNIIHFIYRPITSPADYNRDRMHRVITDYIRVITNRYPYWNRSEGADHFMVSCHDWAP
EMSDANPQLFKNFIRVVCNANITEGFRPDIDISLPEINIHPGTLGPPDLGQPPESRTILA
FFAGGAHGYIRKIMIQHWKEKDKEVQVHEYLPKNQNYTKLIGKSKFCLCPSGYEVASPRV
VEAIYGGCVPVIISDNYSLPFSDVLDWSRFSVQIPVKKIPEIKTILKAISEEKYLKMYKG
VMKVKRHFKINRPAKPFDVIHMLLHSLWLRRLNFGLPH
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcttccgctgcttgttactcccagcatgccttcttcttcttcttcttcttttt
gttcttctgtttctctctattccgccattgttggacctgtcacaagtaactgaagctatt
ccattagcatctttctttcctataactaccatgagagaaggcaacaagcccatgaaagct
atattcatcaaacagaagaagaagacgagcttgaggatgatcgaagcaagtttggctgaa
gctcgagcatcgattcgaaatgcagttcggtggaaaaacttcacatcagagaagaaagaa
acttacattcccagaggctccatttaccgaaatccttatgcttttcatcaaagccatata
gaaatggtggagaggttcaaggtatggagttacagagaaggggaacagcctctggttcat
gatggtccattgaatagcatatacgccattgaaggccaatttatagatgagttagattgc
agcaagagcccttttagagccagccatcctgatcaagctcatgtatttcttcttcctatg
agcattaccaacatcattcatttcatttacagaccaattacctctccagccgactacaac
cgtgatcggatgcaccgtgtgataactgattacattcgagtcattaccaacaggtatcca
tattggaaccgaagcgaaggtgctgatcattttatggtttcatgccatgattgggcacca
gaaatgtcagatgccaacccccaattgttcaagaacttcatcagggtagtatgcaatgca
aacatcacagaaggctttcgtcctgacatagacatttcactcccagaaatcaacatccat
cctggaacgttagggccacctgacttaggccagccaccagaaagccgcacaattctagct
ttcttcgctggaggagctcatggatacataaggaagatcatgatccagcattggaaggaa
aaagacaaagaagttcaagttcatgaataccttcctaagaaccaaaattacaccaaactg
attggaaaaagcaagttttgtctctgcccgagtggctatgaagtggcaagcccgagggtg
gtggaagccatctatggtggttgtgttccggtgatcatttctgataattattcattacca
ttcagcgacgttctagattggagtcggttttcggtgcagatacctgttaagaaaatacca
gaaataaaaacaatcttgaaggctatctcagaagagaagtatttgaagatgtacaaagga
gtgatgaaagtaaagcggcatttcaagataaataggcctgctaagccatttgatgtaatt
catatgctgcttcattcactgtggcttagaaggcttaactttggccttcctcattga

DBGET integrated database retrieval system