KEGG   Cucurbita maxima (winter squash): 111493616Help
Entry
111493616         CDS       T05246                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
cmax  Cucurbita maxima (winter squash)
Pathway
cmax03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    111493616
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cmax03041]
    111493616
Enzymes [BR:cmax01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     111493616
Spliceosome [BR:cmax03041]
 Complex C
  Other components
   Step II factors
    111493616
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C S1 DEAD AAA_22 AAA_19 AAA_30 T2SSE ABC_tran Sigma54_activ_2 AAA_16 AAA_14 PhoH
Motif
Other DBs
NCBI-GeneID: 111493616
NCBI-ProteinID: XP_022999145
Position
Unknown
AA seq 1231 aa AA seqDB search
MVASTANGDDGLKKLEYLSLVSKVCSELETHLGFGDKVLAEFITEMGRRCETVDEFDSKL
KENGAEMPDYFVRSLLRIIHLILPPQKDDNEKEFKKEKESDGKKGKFRALAIGDDKERAK
ELVKEIELEAHQKRGDRDVQDDRYKGRAGDRGRDRDRDRDRDRDRDRDGDRNRNRDRDRD
RDRDGYRDRDWDRDKDRDRRRDRYERDERHGGRDRGDDGGDDYQRSGRPRDRNKRNGYEE
NEGYTGDARDGNGNWRDDRDKHTQNGRHLPVDHEPELYKVYKGRVSRVMDTGCFVQINDF
RGKEGLVHVSQMATRRITNAKDVVKRDQEVYVKVISVSGQKLSLSMRDVDQHSGKDLLPL
KKKDADDGPRMNPSNTKDDGPVVRTGLSGIKIVEDDVTIPSRRPLKRMSSPERWEAKQLI
ASGVLSVNDYPSYDDEGDGLLYQEEGAEEELEIELNEDEPEFLQGQSRYSIDMSPVKIFK
NPEGSLSRAAALQSALIKERREVREQQQRTMLDSIPKDLNRPWEDPMPETGERHLAQELR
GVGLSAYDMPEWKKDAYGKDISFGQKSKLSIQEQRQSLPIYKLKKELIQAVHDNQVLVVI
GETGSGKTTQVTQYLAEAGYTTSGKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIR
FEDCTGPDTVIKYMTDGMLLREILIDDNLSQYSVVMLDEAHERTIFTDVLFGLLKQLVKR
RPDLRLIVTSATLDAEKFSGYFFNCNIFTIPGRTFPVEILYTKQPETDYLDAALITVLQI
HLTEPEGDVLLFLTGQEEIDFACQSLYERMKGLGKNVPELIILPVYSALPSEMQSRIFEP
APPGKRKVVVATNIAEASLTIDGIFYVIDPGFAKQNVYNPKQGLDSLVITPISQASAKQR
AGRAGRTGPGKCYRLYTESAYRNEMSPTTIPEIQRINLGHTTLTMKAMGINDLLSFDFMD
PPSPQALISAMEQLYSLGALDEEGLLTKLGRKMAEFPLDPPLSKMLLASVDLGCSDEILT
IIAMIQTGNIFYRPREKQAQADQKRAKFFQPEGDHLTLLAVYEAWKAKNFSGPWCFENFV
QSRSLRRAQDVRKQLLSIMDKYKLDVVSAGKNFTQIRKAITAGFFFHAARKDPQEGYRTL
VENQPVYIHPSSALFQRQPDWVIYHELVMTTKEYMREVTVIDPKWLVELAPRYFKVADPT
KMSKRKRQERIEPLYDRYHEPNSWRLSKRRA
NT seq 3696 nt NT seq  +upstreamnt  +downstreamnt
atggttgcttccacggctaatggcgacgatggattgaagaagctcgagtacttatccctc
gtctccaaggtatgttctgagctcgaaactcatttagggttcggagataaagtacttgct
gagttcataactgagatgggccggagatgtgagacggtggacgagttcgattccaaattg
aaggagaacggtgccgaaatgcccgattactttgttcgctcgctcctgaggatcattcac
cttattcttcctccgcagaaggatgacaatgagaaggagttcaagaaggagaaggaatca
gatgggaaaaaaggcaagtttagggccttggcgatcggggatgataaggagagagctaag
gagctcgtgaaggaaattgagttggaggctcaccagaagcgtggggacagagacgtacag
gatgatcgatacaaggggagggcaggggaccgaggaagagacagagacagagacagggat
agggatagggatagggatcgagatggtgacagaaatagaaatagagatagagatagagat
agagatagagatgggtacagggatcgggattgggatcgagacaaggatagagataggcgc
agggatagatatgaaagggatgagagacatggtggtagggatcgtggtgatgatggtggt
gatgattatcagagaagtggaaggccaagggatcggaataagaggaatgggtatgaagaa
aatgaaggttacacaggggatgcaagagatggtaatggcaattggagagatgatagggac
aagcatacacaaaatgggcgacacctccctgtcgatcacgaacctgaattgtacaaggtc
tacaagggtagagtttctagagtgatggacacgggttgctttgtccagataaatgatttc
agaggcaaggagggtctggttcacgtttctcagatggctactcgaaggattaccaatgcc
aaggatgttgtaaagcgagatcaagaggtttatgtcaaggttatttcagtttcagggcaa
aagttgagcctttctatgagggacgtggatcaacattctggtaaggatttgcttccgctg
aagaaaaaagatgccgacgatggtcctagaatgaatccttcaaatacgaaggatgatggc
ccagtggttaggactggcctttctggaattaagattgtggaagatgatgttactattcct
tcacgcagacctttgaagagaatgagctcacctgagagatgggaagccaaacaactgatt
gcttctggtgttttaagtgtaaacgactatccttcatatgatgatgagggagatgggcta
ttatatcaagaagagggtgctgaagaggagcttgagattgagttgaatgaagacgagcct
gaatttctgcaaggccagagtagatactcaattgacatgtcgccagttaagatattcaaa
aatccggaagggtctctgagccgggcagctgcacttcaatctgcactgattaaggagcgc
agggaagttcgtgagcagcagcaaaggaccatgctcgattcaattccgaaggatcttaat
cgaccttgggaagaccctatgccagagactggtgagaggcatcttgcacaggagctcagg
ggcgttggcttgtcggcctatgatatgcctgagtggaagaaggatgcttatggaaaagat
attagtttcgggcagaaatcgaagctctctatccaggaacagaggcaaagcttacccatt
tacaagctgaagaaagaacttattcaggccgttcatgataatcaggtacttgttgtcatt
ggtgagactggttcaggtaagacaacccaggtaactcagtatcttgctgaagctggatac
acaacctccggtaaaattgggtgcactcaaccacgtagggtggctgcaatgtctgtcgcg
aagagggttgctgaagagtttggatgtcgcttaggagaggaagttgggtatgcaattcgt
tttgaggattgcactggacctgatactgtgatcaagtatatgactgatggtatgcttctt
agggagattttgattgatgataacttgtcacagtactcggtagttatgcttgatgaagct
cacgagagaacaatcttcactgatgttctttttggattgctgaagcaacttgtgaaaagg
agacctgatcttcgactgattgtcacatctgctactttagatgccgaaaaattttcagga
tatttctttaattgtaatatttttacaattcctgggcgaactttccctgtggagatcctc
tatactaagcagccagaaactgattatcttgatgctgctttaatcacagtcttgcagatc
catttgacagagcctgaaggtgacgtacttcttttcttgactggccaggaggagattgat
tttgcatgtcagtctctatacgagagaatgaaaggactcggtaaaaatgttcccgagtta
attattctaccagtctacagtgccttgcccagtgaaatgcagtccaggatttttgaacca
gctcctcctggtaagaggaaagttgtagtggcgactaacattgctgaggcttcattgaca
atagatggaatcttttatgttattgatcctgggtttgctaaacagaatgtatataaccca
aagcaagggcttgattctcttgttatcacaccaatttcacaagcatcagccaaacaacgt
gcggggcgtgctgggcgaacaggacctggaaaatgttaccgcctctatactgagagtgct
tatcgcaacgagatgtctcctacaacaataccagaaatccagagaatcaatcttggtcat
actactcttactatgaaagccatggggataaatgatctcctatcatttgattttatggat
ccaccttcaccccaagcactaatttcagcaatggaacaactttacagtctaggagcactg
gacgaagaaggacttctgactaagttgggtagaaaaatggccgaatttcctttagatcca
cctttgtctaagatgctgctagctagtgtggatcttggatgtagtgatgagattttgacc
ataattgcaatgattcagactggaaatatcttttacaggccaagggaaaaacaagcccag
gctgatcagaaaagggccaagtttttccagccagagggagatcatcttactttgcttgca
gtttatgaggcgtggaaagccaaaaacttttcaggcccttggtgttttgaaaactttgtt
caatctcgatccttgaggagagcacaggatgtgaggaaacaacttctttcaattatggac
aagtataaactggacgtggtgagtgcaggcaagaatttcacacagataaggaaggcaatt
acagcagggttctttttccacgcagccagaaaggatcctcaagagggttatcgaacgcta
gttgagaaccaaccggtttatatccatccaagcagcgctttattccaaagacaacccgac
tgggtcatataccacgagctagtcatgacaacaaaagagtacatgcgtgaagtgacagtc
atagatcccaaatggcttgttgaactagctccaagatacttcaaagttgcagacccaaca
aagatgagtaagcgaaagcgacaagagcggatcgaaccactctacgacaggtatcacgaa
cctaactcttggcgattgagtaagagacgagcttaa

DBGET integrated database retrieval system