KEGG   Cucurbita maxima (winter squash): 111493850Help
Entry
111493850         CDS       T05246                                 

Definition
(RefSeq) protein phosphatase 1 regulatory inhibitor subunit PPP1R7 homolog
  KO
K17550  protein phosphatase 1 regulatory subunit 7
Organism
cmax  Cucurbita maxima (winter squash)
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cmax01009]
    111493850
Protein phosphatases and associated proteins [BR:cmax01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111493850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_4 LRR_8 LRR_9 LRR_6 T4_Rnl2_C
Motif
Other DBs
NCBI-GeneID: 111493850
NCBI-ProteinID: XP_022999515
Position
Unknown
AA seq 340 aa AA seqDB search
MDAVYESSSVLESKEDDPMIVDDLNSTVLDLTSFQLHDLDSIELPSSLMELDLTANRLSS
LDSRIGELSNLKKLSLRQNLINDAAVESLSRWNALSGLEELILRDNQMTKIPDASIFKRL
LVFDVSFNEITSLHGLSKVSDSLTELYVSKNEVVKMEELDHFHQLQILELGSNRLRVMEN
LRNLVNLQELWLGRNRIKAVNLCGLRCLQKISLQSNRLTSMTGFEGCIALEELYLSHNGI
SKIEGISTLVNLRILDVSSNKLTSVSGTEKLTRLEDLWLNDNQIESLESISEDVAGSREK
LTTIYLENNPCAKTPNYFARLKQIFPNIQQIDSEIFTKNF
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggacgctgtatacgaatcatcgtcggttttggaatcgaaggaggatgatccgatgata
gtagatgatctcaattctacggttctcgatctcaccagctttcagctccacgacctggac
tctattgagttgccttcgagtttaatggaattggacctgacggcaaatcgactttcgagt
ttggactctcggattggagagctctcgaacctgaagaagctctctcttcgtcagaatctc
attaatgatgctgcggttgaatcgctttctcgctggaacgctctgtcaggtctcgaggaa
cttattctcagagacaatcaaatgacgaaaattcctgatgcgagcatattcaagaggctt
ttggtatttgatgtttctttcaacgaaatcacttcgttacatggcttgtccaaggtctcc
gattcactgacggaactatatgtatctaagaatgaagttgttaaaatggaagagctagat
cacttccatcagttacagattcttgagcttggttccaatagactgcgggtaatggagaac
ttgcgaaacttagtgaatttgcaagagctatggttagggcgtaaccggatcaaggcagta
aacctttgtggactaagatgtctccagaaaattagtctgcaaagcaaccgtttgacttca
atgacaggatttgagggctgtattgctttggaagaactatatctgagccataatggaatt
tcaaaaattgaaggcatttcaacgttagtcaatcttcgtattttggatgtttcatcgaat
aagctaacgagtgtgagtggcactgaaaaactgacacgtttagaagatttatggcttaac
gacaaccaaattgaatcacttgaaagtatttctgaggatgttgcaggttcaagagagaaa
ctgacaaccatctaccttgagaacaatccatgtgcaaagactccaaactattttgccaga
ctaaaacagattttcccaaacatacaacaaattgactcggagatctttacaaagaacttt
tga

DBGET integrated database retrieval system