KEGG   Cucurbita maxima (winter squash): 111494445Help
Entry
111494445         CDS       T05246                                 

Definition
(RefSeq) mitogen-activated protein kinase 15-like
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
cmax  Cucurbita maxima (winter squash)
Pathway
cmax04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111494445
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cmax01001]
    111494445
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cmax03036]
    111494445
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmax04147]
    111494445
Enzymes [BR:cmax01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     111494445
Protein kinases [BR:cmax01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   111494445
Chromosome and associated proteins [BR:cmax03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     111494445
Exosome [BR:cmax04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111494445
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 111494445
NCBI-ProteinID: XP_023000160
Position
Unknown
AA seq 565 aa AA seqDB search
MQHDQRRKSSMDVDFFTEYGEGSRYKIEEVIGKGSYGVVCSAYDTHTGDKVAIKKINDIF
EHVSDATRILREIKLLRLLRHPDIVEIKHILLPPSRREFRDIYVVFELMESDLHQVIKAN
DDLTPEHYQFFLYQLLRGLKYIHTANVFHRDLKPKNILANADCKLKICDFGLARVAFNDT
PTAIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQL
DLMTDFLGTPNAEAIARIRNEKARRYLSSMRKKKSVPFSQKFPHADPLALPLLERMLAFE
PKDRPTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYH
PKMLKEFLDGSEPTSFMYPSAVDHFKKQFAYLEEHYGNGATVAPPERQHASLPRQCVLYS
DNMVQNSAQVVNDLSKCSIKEVERPQVDRTCNIPSTRAPIQVPQSIQGNAVRPGKVVGSV
LRYNCGATASAVVPEVLEQRRTTRNPSIPPQYAPNNCSYPRRNSSCKNDTTEDEVIEGSN
GLQPKPQYIARKVAAAQGGPGNNWY
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacgatcagagaagaaagtcgtctatggatgtggatttcttcacagaatatggt
gaagggagcaggtataaaatagaggaagtaattggtaaaggaagttatggtgttgtttgc
tctgcatatgatactcatactggggataaagttgcaattaagaaaatcaacgatatcttt
gagcatgtctctgatgcaactcgcattcttcgtgagataaaacttttaagactattgaga
catccagacattgtagagataaagcacatcctactacctccatctagaagggaattcagg
gatatatatgttgtgtttgagctcatggaatctgatttacaccaagttatcaaagcaaac
gacgatttgactccagaacattatcagttctttctttaccagcttcttcgtggcttgaaa
tatatacacacagcaaacgtcttccacagggacctaaaacccaaaaacatcttagcaaat
gctgactgcaaactcaagatctgtgactttggtctagccagagttgcttttaatgatact
cctactgctattttctggactgactatgtagcaacaaggtggtacagggcacctgaactg
tgcggttcatttttctcaaagtatacaccagcaatagatatatggagcattggttgcatc
ttcgcagagcttttaactggaaaaccacttttccctggaaagaatgtcgtgcaccaatta
gatttgatgacagattttctgggaacccctaatgcagaagccattgccaggatacgaaat
gagaaagctcggagatacttaagcagtatgcgaaagaagaagtctgttcctttctcccag
aagtttcctcatgcagatcccttagcacttcccttattggaaagaatgttggcttttgag
ccaaaggatcgacctacagcagaggaggcccttgcagatccatattttaaaggcttagcg
aaggttgaaagagagccatctgctcaacctgttactaagatggaatttgaatttgagaga
cgaagaattaccaaagaagatgttagggagcttatttaccgggaaattctcgagtaccat
ccaaagatgttgaaggagttcttagatggatcagaacctaccagtttcatgtatccaagt
gcagttgaccattttaagaagcaatttgcataccttgaagaacactatggaaatggtgca
accgttgcccctcctgaaagacaacatgcatccttgcctaggcaatgtgttttatattca
gataacatggtacagaactcggcacaagttgtgaatgacctatccaaatgttccatcaaa
gaagttgagaggccacaagtggataggacttgcaatattccttcaactagagctcctatt
caagttcctcaatctattcaaggcaatgctgtaaggcctggaaaagttgttggctctgtg
ttgcgatacaactgtggggctacagcatccgcagtggtaccagaagttcttgaacagcgg
aggacgaccagaaacccttccattccaccacagtacgcccctaataactgttcatatcct
agaagaaactcatcatgtaaaaatgatacgactgaagatgaagtcattgaaggttcgaat
ggactgcagccaaaacctcagtacatagctagaaaagttgctgctgcccaaggtggacca
ggaaataactggtactga

DBGET integrated database retrieval system