KEGG   Cucurbita maxima (winter squash): 111495085Help
Entry
111495085         CDS       T05246                                 

Definition
(RefSeq) DEAD-box ATP-dependent RNA helicase 51
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
cmax  Cucurbita maxima (winter squash)
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cmax03041]
    111495085
   03009 Ribosome biogenesis [BR:cmax03009]
    111495085
Enzymes [BR:cmax01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     111495085
Spliceosome [BR:cmax03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    111495085
Ribosome biogenesis [BR:cmax03009]
 Eukaryotic type
  90S particles
   Helicases
    111495085
  Pre-60S particles
    111495085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C DUF4217 AAA_22
Motif
Other DBs
NCBI-GeneID: 111495085
NCBI-ProteinID: XP_023000723
Position
Unknown
AA seq 615 aa AA seqDB search
MVALDEKVPSSSEVEAMDKRRKRKRPKKNLPSTGAEESEPQNPMKAEEEGEGDAEGNVSE
EKVKKGEKMNKKKRKTKKKGELEEEGHETANDGEGEDDVDGKVEKDEEKVNEKKKVKTGG
SGIMSTVSFDSLELSEKTLRAIKDIGFQHMTQIQARSIPPFLTGKDVLGAARTGSGKTLA
FLIPAVELLHHISFTPRNGTGVIVICPTRELAMQTHDVAKELLKYHSQTLGLVTGGSSRQ
AEADRITKGVNLLIATPGRLLDHLQHTKNFVFKNLKCLIIDEADRILETNFEEEMKQIIK
LLPKNRQTALFSATQTQKVEDLVRLSFQSTPIYIDVDDGRTKVTNEGLQQGYCVVPSAKR
FVLLYSFLKRNLSKKIMVFFSSCNSVKFHADLLRYIKVDCMDIHGKQKQQKRTSTFFAFN
KAETGILLCTDVAARGLDIPAVDWIVQYDPPDEPKEYIHRVGRTARGEGNKGNALLFLIS
EELQFLRYLKDAKVPVKEYEFSDKKLANVQSHLEKLVGSNYYLNKSAKEAYRSYLLAYNS
HSIKDIFNVHRLDLQAIAASFCFSNPPKVNLNIDSGASKFRKKTRNVEGSKNRFSESNPY
GRKNGDEDERQFVRY
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atggttgcactggacgagaaagttccctcttcatcagaggttgaggcaatggacaaaagg
cgcaagaggaagagaccaaagaaaaatcttccttcaacgggtgctgaagaatcggaacct
caaaatccaatgaaagctgaagaagaaggggaaggagatgctgaaggtaatgtatcagag
gagaaagtgaaaaaaggtgagaagatgaacaagaagaagaggaagacgaaaaagaagggc
gagttggaggaggaaggacatgaaactgctaatgatggtgagggagaggatgacgtggat
gggaaagttgagaaggatgaggagaaagtgaacgagaaaaagaaggttaagactggtggc
tcaggaattatgagtacagtttcgtttgattcgcttgaattgtcggagaaaactctccgg
gcgattaaagacattggatttcagcatatgactcagattcaagccagatcaattccacct
tttctgactggcaaagatgttcttggagccgcaaggactggatccgggaaaacccttgcc
tttcttataccagctgttgaactactccatcacatcagctttactcctcgtaatggaact
ggtgttatcgttatttgcccaacacgggagcttgcaatgcagacacatgatgtggcaaaa
gagcttctcaaatatcattcacagacacttggccttgttactggtggttctagccgacaa
gctgaggcagatcgtattacaaaaggggtcaatctgttaatagcaacccctggtcgactt
cttgaccatcttcaacataccaagaattttgtgtttaaaaatttgaagtgcctcataatt
gatgaagcggacaggatattggaaaccaattttgaggaggaaatgaaacagattataaag
ctcctaccaaagaatagacagactgctttattctcagcaacccaaactcaaaaggttgaa
gatcttgttcgcctgtcttttcagtcgactcctatttatattgatgtagatgatggaaga
accaaggtcaccaatgaggggttgcaacaaggttattgtgttgtgcccagtgctaaaaga
ttcgttcttctatattccttcttgaagagaaatttatctaagaaaattatggtcttcttc
tcgtcttgtaactccgtcaaattccatgcggaccttcttagatacattaaggtcgattgc
atggatattcatggaaaacaaaagcagcagaagagaacttctaccttctttgccttcaac
aaggctgagacggggatcctactatgtactgatgttgctgcacgtggacttgacatcccc
gctgttgattggattgtgcaatatgatcctccagatgaacccaaggaatatattcacaga
gttggtcgaacagctcgaggcgagggtaacaaaggaaatgccctacttttcttgatttct
gaagagcttcaatttcttcgctatttaaaggatgcgaaagttcctgtcaaagagtatgag
ttcagtgataagaaattagccaacgtgcagtctcatctggaaaagctggttgggagcaat
tattatttgaacaagtccgctaaggaagcttacagatcctatttattagcttacaattca
cactctataaaagatattttcaacgtccaccgccttgatctccaggctattgctgcttca
ttctgcttttccaaccctccaaaggtcaaccttaacatcgacagcggtgcctcgaaattc
aggaagaaaacgcgcaacgtagaagggagcaaaaaccgattcagtgagagcaacccttat
gggaggaagaatggcgatgaggatgagagacaatttgtaagatactaa

DBGET integrated database retrieval system