KEGG   Cucurbita maxima (winter squash): 111498091Help
Entry
111498091         CDS       T05246                                 

Definition
(RefSeq) nodulation receptor kinase-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
cmax  Cucurbita maxima (winter squash)
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cmax01001]
    111498091
Enzymes [BR:cmax01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111498091
Protein kinases [BR:cmax01001]
 Serine/threonine kinases: TKL group
  IRAK family
   111498091
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Malectin_like Malectin LRR_8 LRR_4 ABC1 APH LSR
Motif
Other DBs
NCBI-GeneID: 111498091
NCBI-ProteinID: XP_023004931
Position
Unknown
AA seq 916 aa AA seqDB search
MKGGLYNWLIILIFVHPTTAQEGFVSLACCADSNFKDTNTSIDWAQDSQWLESSSSCKNI
SSNGKARIFGMDMGKRACYHLSTVEGQEYVIRGTFLVAAGGSSFRVYLGSTLLGLVRSFQ
DSVVEGSFRGKRSYEEFCLEKDKGQPFISFLELRRLHDFRYLSPFPSHLLKLIARVNVGV
STSLDIRYRDDSSDRIWKASPYFQNEARVLTEPSINISSKSDHNATHGVPLKVLRTGLTH
SDQLVFLHDGLDSATYQYRIFFHFVELNQSVKPGQRLFDIYINNEKKATDYDILAHGFNY
EWEVYDVLGNGSLNLTLVKASVGSELGPICSAYEILQVRSWSLESDEKDVEVILKVRDEL
LVANQENEMLGSWSGDPCLSIPWDGLGCDTINGSSVITKLDLSSRKFKGLFPGSLPKLVH
LQTLNLSNNGFNGRIPSFPASSVLISVDLRHNDFSGGLPESLAFLPQLKSLNFGCNPSFG
KELPPNFNMSRLTTDYGTCDNTAPTFLRRGLVVGTVVSGSVLFTIIIGVIYVCCCRQKSV
FRGRYDMKRELMLNDIIISLPSIDDTSIKSICIQSFTLEYIEAATQQYKTLIGEGGFGSV
YRGTLPDGEEVAVKVRSSTSTQGTREFENELNLLSTIRHENLVPLLGYCCENDQQILVYP
FMSNGSLQDRLYGELAKRKTLDWSTRLSIALGAARGLTYLHTFAERCVIHRDVKSSNILL
DHSMSAKVADFGFSKYAPQEGDSGASLEVRGTAGYLDPEYYTTHHLSAKSDVFSFGVVLL
EIICGREPLNIHKPRNEWSLVEWAKANLRESKVDEIVDPSIKGGYHTEAMWRVVEVALAC
IEPSSAYRPCMADIMRELEDALIIENNASEYMRSIDSLGGSNRFSMAMERKLVQPPTPTP
TEPSPISHELAPPEPR
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgaagggaggactttataattggctgattatcctcatatttgtgcacccaactacggca
caagagggttttgtgagcctagcatgctgtgcagattcaaacttcaaggacacaaacaca
agcattgattgggcacaagattcccagtggttggaaagttcatcaagctgcaaaaacata
agcagcaatgggaaagctcgaatctttggcatggacatggggaagagagcttgctaccat
ttaagcactgtggaagggcaagaatatgtgataaggggcacgtttcttgtggctgccggg
ggctcatcctttcgtgtttatcttgggagtacccttctgggtttggtgaggtcgttccag
gactcggtggttgaaggaagcttcagaggtaaaaggagctatgaagagttttgcttggag
aaggataagggacagccttttatatcctttcttgagcttcgaaggcttcatgattttaga
tatctctccccctttccttctcaccttctcaaattgattgccagagttaatgttggggta
tccacatcattggatatcaggtacagagatgactcgagcgatagaatttggaaagcatcg
ccatatttccagaacgaagctcgggtcttgacagagcccagtatcaatatttcatccaag
tccgaccacaatgccacgcatggtgttcctttgaaagtcctccgaactggtcttacacat
tccgaccagctggttttcctccacgatggcctcgattcagctacttaccagtatcgtatc
ttctttcactttgttgagctcaaccagagtgttaaacctgggcagagattgttcgacatt
tacataaacaatgaaaagaaagcaaccgattacgacattctagctcatgggttcaactac
gagtgggaagtttatgatgttttgggtaatgggtcacttaatttgaccttggttaaggcc
tccgtcgggtctgagttaggacccatttgcagtgcttatgagatcttgcaagtgcgttca
tggagtctggagtccgacgagaaggatgtggaagtaattttgaaggtgagggatgaactg
ttagttgctaaccaagaaaatgaaatgttgggcagctggtcaggggatccttgcctttcg
attccctgggacggtctgggttgtgataccatcaatggatcctctgttatcaccaaactg
gacctctcttcacgtaaattcaaaggattgtttcctggcagtttacccaagttggtccat
ttacaaactctgaacctcagcaacaatggcttcaatggacgcatcccatcttttcccgct
tcttcagtgctgatatcagtggatctgaggcacaatgattttagtggagggctccctgaa
tctcttgctttcttgccacaattaaaatcattaaactttgggtgcaatccttcctttggc
aaggagcttccacccaacttcaacatgtcaagacttactacagactacggaacgtgtgat
aatacagcaccaacatttctgagacgaggacttgtcgtagggacggttgtgagtggatca
gttctatttaccattattattggtgtcatttatgtgtgctgttgcagacagaaatctgta
tttaggggaagatatgatatgaaaagagaacttatgttgaatgatataatcatttctcta
cccagcatagacgacacctctataaaatcaatatgcattcaatcatttactctcgagtac
attgaagctgctacccaacaatacaaaactttaattggtgaaggagggtttggttctgtt
tatcgtggcactttgcctgatggtgaggaagtggctgtcaaggtccgttcttccacatcg
acccagggaacgcgggaatttgaaaatgagctaaacctgctttcaactattaggcatgaa
aacctggtacctcttcttggctattgttgtgaaaacgaccaacaaattcttgtttaccct
tttatgtcaaatggatcactacaagatcgtctttatggcgaactagcaaagaggaagaca
ctggactggtccacaagactttcaattgcacttggtgctgccagaggtttgacgtatctt
cacacgtttgctgagcgatgtgttatacatagagatgtaaaatcaagcaatatactttta
gatcatagtatgtctgccaaggttgcagattttgggttctcaaaatatgcacctcaagag
ggtgacagtggtgcctctctggaggtcagaggaactgctggatatttagatcctgagtac
tatacgacccatcatttgtctgctaaaagcgatgtgttcagctttggtgtggttctcctt
gaaatcatatgcggtcgggagccactgaacattcataaaccacgcaatgaatggagcttg
gttgaatgggccaaagctaatctgagagagtcgaaggttgacgagattgtggatccttcc
atcaaaggagggtaccatacagaggcaatgtggagagttgtggaggtggcattggcatgt
attgagccatcctcggcctatcgaccgtgcatggctgacatcatgcgtgagctagaggac
gctttaatcatagagaacaacgcctcagaatacatgaggtctatagacagtttgggagga
tccaatcgtttctcaatggccatggaaaggaagttggttcaaccacccactcccactcca
acagagccatcgccaatctctcatgagttagccccgccagagccaaggtag

DBGET integrated database retrieval system