KEGG   Cucurbita maxima (winter squash): 111498110Help
Entry
111498110         CDS       T05246                                 

Definition
(RefSeq) autophagy-related protein 16
  KO
K17890  autophagy-related protein 16-1
Organism
cmax  Cucurbita maxima (winter squash)
Pathway
cmax04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    111498110
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cmax04131]
    111498110
   03029 Mitochondrial biogenesis [BR:cmax03029]
    111498110
Membrane trafficking [BR:cmax04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    111498110
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    111498110
Mitochondrial biogenesis [BR:cmax03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    111498110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ATG16 ANAPC4_WD40 Nup160 eIF2A Ge1_WD40 PQQ_2 zf-C4H2 Cytochrom_D1 DUF4094 DUF3584 DUF4854 Filament
Motif
Other DBs
NCBI-GeneID: 111498110
NCBI-ProteinID: XP_023004970
Position
Unknown
AA seq 511 aa AA seqDB search
MIMSPNEIANNAIRHALRALRQRHLVEEGAHAPAFLALSRPIISQSSEWKEKAEKLELEL
QQCYKAQSRLSEQLVVEVAEGRASKSSIEEKDATIDNLQQELTRARDECSQLKADLEMKI
KAMELAISESQELKAQLEAMTIKAKNTEAENNMLIDRWMLQKMKDAERLNEANALYEDMI
DRLKASGLEKLAQQQVDGVVRQSEEGAEYFVESTVPSVCKHSIRAHEGGCGTILFENNSG
KLISGGQDRTVKVWDTNTGSLSSTLHGCLGSVLDLAVTHDNRSVIAASSSNNLYVWDVGS
GRVRHTLTGHSDKVCAVDVSKISSRHVVSAAYDRTIKIWDLQKGYCTKTLIFPSNCNAVR
FSMDGQTICSGHMDGNLRLWDIQTGKLLSEVAGHSLAVTSLSLSRNGNTILTSGRDNLHN
LFDIRSLEVCGTLRASGNRVASNWSRSCISPDDNHVAAGSADGSVHVWSISKHDIVSTLK
EHTASVLCCSWSGLGKPLASADRNGIIFTWN
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgatcatgtccccaaacgagatagcaaacaatgcgatcaggcacgctctcagggcgctg
cgccaacgccatctagttgaagaaggtgcgcatgctcccgcttttctcgctctctctcgg
cccatcatatcgcagagttcggaatggaaagagaaagcagagaagctggagttggagctt
cagcaatgttacaaggctcaatcgcgattgtctgagcaacttgtggtggaagtggctgag
ggtcgagcttctaaatcttcgattgaggagaaagatgcgacgattgataatctgcagcag
gagttaactcgagccagggatgaatgctcccagttaaaggcagacttagagatgaaaatt
aaagccatggaactggctatatctgagagccaagaacttaaagcacagcttgaagcaatg
acgattaaagctaagaatacagaggctgaaaataatatgttgattgaccggtggatgctg
caaaagatgaaggatgcagaacgcctcaatgaggcaaatgcactctatgaagatatgatt
gaccgactcaaggctagtggtttagagaaacttgctcagcaacaggtcgatggtgtggtc
cgtcagagtgaagagggtgctgaatacttcgtagaatccaccgtaccctctgtatgtaag
catagtatccgtgcgcatgaagggggctgtggtactattttgtttgaaaacaattcagga
aagttgatcagtggggggcaggaccgaaccgtaaaagtgtgggatacaaatactggatca
ctaagttccactttacatgggtgccttggttctgttcttgatcttgcagttacccatgat
aatagatctgtcattgcagcaagcagttcaaacaacttatatgtgtgggacgttggttct
ggaagggtgcgccatacgcttactggtcactccgacaaagtatgtgctgtagatgtaagc
aaaatctcgagccgacatgttgtgagtgctgcatatgatcgcaccatcaaaatctgggat
ttacagaagggttactgcactaagacgctcattttccccagcaattgcaatgcagttcgg
ttcagcatggatggacagaccatttgttctgggcatatggatggaaatcttcggttgtgg
gatatccaaacaggaaaattgctcagcgaagttgctggacactcccttgctgttacatct
ctttctttgtcacgtaatggcaatacgatattgactagcgggagagataacttgcataat
ttattcgatattcggtctttggaagtctgcgggacattacgggcatctgggaatagagta
gcttccaattggagccgttcttgcatcagcccagatgacaaccatgttgctgctggttcc
gctgatggatctgtccatgtctggtcaatatcaaagcatgatattgtgagcactctgaaa
gagcacactgcctctgttctgtgttgttcatggagtgggcttgggaaaccccttgcgtct
gcggacagaaatggaattatatttacatggaactga

DBGET integrated database retrieval system